BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C01 (509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 4.5 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 6.0 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 6.0 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 6.0 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 23 6.0 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 6.0 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 6.0 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 6.0 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 6.0 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 6.0 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 6.0 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 6.0 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 6.0 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 6.0 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 6.0 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 6.0 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 6.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.0 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 23 7.9 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 23 7.9 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 7.9 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 4.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 219 KPIGHCYRITCGGSMIDYA 275 K G CY++ C G+++D A Sbjct: 62 KCCGPCYQLNCYGTVLDCA 80 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/32 (21%), Positives = 14/32 (43%) Frame = -1 Query: 338 LLGVYLCDVAMFVICSDNTTRSVINHASSTGN 243 ++ + C V + ++C T I+ GN Sbjct: 1 MMSLQACQVVLLLVCVTATVHGAIHEIKQNGN 32 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.0 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 243 ITCGGSMIDYASCGVVATNDEHCHVTEIDPKKPY 344 ++ GS + A VAT+ + VT ++P+K + Sbjct: 1261 VSQAGSRKNSADSNSVATHSSYYSVTGVEPEKEF 1294 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 324 IDPKKPYPECCPDIKCDSE 380 I+PK +PEC P+ D + Sbjct: 119 IEPKGKHPECVPNQCADGK 137 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 22.6 bits (46), Expect = 7.9 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = -1 Query: 323 LCDVAMFVICSDNTTRSVINHASSTGNSVAMSDGLEFCSKRYH 195 LCD F C + +A SD L CSK H Sbjct: 59 LCDTRHFCECKETREPLPYMYACPGTEPCQSSDRLGSCSKSMH 101 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.6 bits (46), Expect = 7.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +3 Query: 69 SKILIISMIVCTVNAAVWIGA 131 ++ + I+ + CTVN +W G+ Sbjct: 808 ARAMDIAKVTCTVNTFLWDGS 828 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,967 Number of Sequences: 2352 Number of extensions: 12458 Number of successful extensions: 66 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -