BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B24 (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. 23 6.1 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 23 6.1 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 8.1 >DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. Length = 403 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 303 LWDL-ETGKNIATI-KTNSSVRTCNFSFSAYQAAYTTDK 413 LW L E+G + + + T NFS S Y+AA+ ++ Sbjct: 11 LWVLAESGSGVGGLTQLRFPYSTTNFSLSLYKAAFKPEQ 49 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -1 Query: 473 NRFIDSSGIYNEYLTRMTHSLISSICSLVCTKAEITCSHRGICFY 339 +R++ S LTR+ L S+ SLV + S + + +Y Sbjct: 115 DRYVQESDTIRNQLTRLRDELRSTYRSLVLMSVQGGASKQALKYY 159 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 112 HKSNIIARVIFYSPPQRMLSQ 174 H ++I + + SPP MLSQ Sbjct: 565 HLISLIDEISYVSPPSPMLSQ 585 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,062 Number of Sequences: 2352 Number of extensions: 12245 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -