BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B23 (310 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) fa... 30 0.36 At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR... 29 0.48 At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) fa... 28 1.1 At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) fa... 28 1.1 At4g37110.1 68417.m05256 expressed protein 28 1.5 At4g15075.1 68417.m02316 hypothetical protein 28 1.5 At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) fa... 27 1.9 At2g46160.1 68415.m05740 zinc finger (C3HC4-type RING finger) fa... 27 1.9 At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 23 2.3 At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P1... 27 2.6 At5g57750.1 68418.m07219 zinc finger (C3HC4-type RING finger) fa... 27 3.4 At5g40070.1 68418.m04861 hypothetical protein contains similarit... 27 3.4 At3g48320.1 68416.m05273 cytochrome P450 71A21, putative (CYP71A... 27 3.4 At2g37580.1 68415.m04610 zinc finger (C3HC4-type RING finger) fa... 26 4.5 At1g55530.1 68414.m06353 zinc finger (C3HC4-type RING finger) fa... 26 4.5 At1g09740.1 68414.m01093 ethylene-responsive protein, putative s... 26 4.5 At5g20910.1 68418.m02483 zinc finger (C3HC4-type RING finger) fa... 26 5.9 At4g30400.1 68417.m04318 zinc finger (C3HC4-type RING finger) fa... 26 5.9 At5g01240.2 68418.m00032 amino acid permease, putative strong si... 25 7.8 At5g01240.1 68418.m00031 amino acid permease, putative strong si... 25 7.8 At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide... 25 7.8 At4g00630.1 68417.m00087 K+ efflux antiporter, putative (KEA2) M... 25 7.8 At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) fa... 25 7.8 At2g38120.1 68415.m04679 amino acid permease, putative (AUX1) id... 25 7.8 At2g21050.1 68415.m02499 amino acid permease, putative similar t... 25 7.8 At1g77690.1 68414.m09046 amino acid permease, putative similar t... 25 7.8 At1g65040.2 68414.m07372 zinc finger (C3HC4-type RING finger) fa... 25 7.8 At1g65040.1 68414.m07373 zinc finger (C3HC4-type RING finger) fa... 25 7.8 >At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 401 Score = 29.9 bits (64), Expect = 0.36 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 24 HHLVAKAKSSATMTARAISEN-LKHVCCLRTWSLLFRSAPICCTNLPASKLT 176 H V K +AR + N + H C+ W + S P+C LPA LT Sbjct: 200 HCAVCKENFVLKSSAREMPCNHIYHPDCILPWLAIRNSCPVCRHELPAEDLT 251 >At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1036 Score = 29.5 bits (63), Expect = 0.48 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 129 RSAPICCTNLPASKLTHIKWFHSM 200 RS PIC T P+S +H KW H + Sbjct: 13 RSCPICATPFPSSSSSH-KWTHQV 35 >At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 525 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 104 PTDLEPALSFCTHLLYKSAG 163 PTD P+LSFC +Y S G Sbjct: 321 PTDPNPSLSFCPSNIYSSTG 340 >At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHX1a [Arabidopsis thaliana] GI:3790591; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 423 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPASKLTH 179 HV C+ TW L + P+C +NL + +H Sbjct: 150 HVECIDTWLLSHSTCPLCRSNLLSGFSSH 178 >At4g37110.1 68417.m05256 expressed protein Length = 417 Score = 27.9 bits (59), Expect = 1.5 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 188 PFYMCQLGCRQICTADGCRTKEQAPSP*AAY-VLEIL*YSSCCH 60 P ++C + CR IC CRTK+ AAY + L Y S H Sbjct: 228 PDWICPV-CRDICNCSFCRTKKGWLPTGAAYRKIHKLGYKSVAH 270 >At4g15075.1 68417.m02316 hypothetical protein Length = 168 Score = 27.9 bits (59), Expect = 1.5 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 87 LKHVCCLRTWSLLFRSAP 140 L++ CCL+T ++LF+S P Sbjct: 126 LRNACCLKTATILFKSTP 143 >At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 396 Score = 27.5 bits (58), Expect = 1.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPAS 167 HV C+ W L S P+C LP+S Sbjct: 282 HVRCIVPWLELHSSCPVCRFELPSS 306 >At2g46160.1 68415.m05740 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 214 Score = 27.5 bits (58), Expect = 1.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPIC 146 H+CCL W L S P+C Sbjct: 162 HLCCLDAWLKLNGSCPVC 179 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 23.0 bits (47), Expect(2) = 2.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 125 LSFCTHLLYKSAGIQADTYKMVSLNENLDIDR 220 LS C HLL S G+ A+ +E LD+++ Sbjct: 542 LSLCKHLL--SEGMGAEAASQAFNSEKLDMEK 571 Score = 22.6 bits (46), Expect(2) = 2.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 20 PASPSSQSKVLCYYDSKSYIRESQARMLPTDLE 118 P+ P SQS C+ SK +RE ++ D E Sbjct: 486 PSQPLSQSFDPCFNTSKLDLREDESSSGGLDAE 518 >At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P14714 Phytochrome C {Arabidopsis thaliana} Length = 1111 Score = 27.1 bits (57), Expect = 2.6 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -2 Query: 267 GNCLFKFVIAR*LACARSMSKFSLSETILYVSAWMPADLYSRWVQNERAGSKSVG 103 G C+ VIAR A + M + L I++ + +P DL Q R G+ G Sbjct: 1019 GLCVSFKVIARIEAIGKRMKRVELEFRIIHPAPGLPEDLVREMFQPLRKGTSREG 1073 >At5g57750.1 68418.m07219 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 210 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPASKLT 176 HV C+ TW L + P+C NL LT Sbjct: 146 HVECIDTWLLTNSTCPLCRDNLLLLGLT 173 >At5g40070.1 68418.m04861 hypothetical protein contains similarity to hypothetical proteins of [Arabidopsis thaliana] Length = 157 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 216 SMSKFSLSETILYVSAWMPADLYSRWVQNERAGSKSVG 103 S S +SL+ T L YS WVQN++ K+ G Sbjct: 10 SSSSYSLASTSLSNRLETQEKRYSSWVQNKKKKKKNKG 47 >At3g48320.1 68416.m05273 cytochrome P450 71A21, putative (CYP71A21) identical to Cytochrome P450 71A21 (SP:Q9STL2) [Arabidopsis thaliana] Length = 490 Score = 26.6 bits (56), Expect = 3.4 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +3 Query: 30 LVAKAKSSATMTARAISENLKHVCCLRTWSLLFRSAPICCTNLPASK 170 LVA SS + A++E L+H CLRT R+ IC NL S+ Sbjct: 290 LVAGTDSSYALMDWAMTELLRHPECLRTLQEEVRT--ICKGNLSVSE 334 >At2g37580.1 68415.m04610 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 235 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPASKLT 176 HV C+ TW + PIC T++ + T Sbjct: 166 HVLCIETWLKDHPNCPICRTDVSVKQQT 193 >At1g55530.1 68414.m06353 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 351 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPASK 170 H CL W L S P+C LPA + Sbjct: 246 HSDCLLPWLELHSSCPVCRYQLPADE 271 >At1g09740.1 68414.m01093 ethylene-responsive protein, putative similar to ER6 protein [Lycopersicon esculentum] GI:5669654; contains Pfam profile PF00582: universal stress protein family Length = 171 Score = 26.2 bits (55), Expect = 4.5 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = +2 Query: 77 IRESQARMLPTDLEPALSFCTH--LLYKSAGIQADT-YKMVSLNENLDIDRAHANYRAIT 247 I + Q R+ T LE A C + K+ + D YK+ ENL D RA Sbjct: 79 IEQHQKRITDTILEHASQICAEKSVNVKTQVVIGDPKYKICEAVENLHADLLVMGSRAYG 138 Query: 248 NLKRQF 265 +KR F Sbjct: 139 RIKRMF 144 >At5g20910.1 68418.m02483 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 310 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPASKLTHIKW 188 H CL+ W S PIC LP + W Sbjct: 253 HPPCLKPWLDEHNSCPICRHELPTDDQKYENW 284 >At4g30400.1 68417.m04318 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHX1a [Arabidopsis thaliana] GI:3790591; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 472 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 93 HVCCLRTWSLLFRSAPICCTNLPASKLTH 179 H+ C+ TW L + P+C ++L + +H Sbjct: 158 HMDCIDTWLLSHSTCPLCRSSLLSDLSSH 186 >At5g01240.2 68418.m00032 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 408 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 108 RTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTLIG 221 RTW+ +F + CC I FH+ RIW+ +G Sbjct: 97 RTWTYIFGA---CCATT-----VFIPSFHNYRIWSFLG 126 >At5g01240.1 68418.m00031 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 488 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 108 RTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTLIG 221 RTW+ +F + CC I FH+ RIW+ +G Sbjct: 177 RTWTYIFGA---CCATT-----VFIPSFHNYRIWSFLG 206 >At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) identical to SWISS-PROT:P17745 elongation factor Tu, chloroplast precursor (EF-Tu) [Arabidopsis thaliana] Length = 476 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 8 ATNHPASPSSQSKVLCYYDSKS 73 A + PA+ SS S++LC Y S S Sbjct: 2 AISAPAACSSSSRILCSYSSPS 23 >At4g00630.1 68417.m00087 K+ efflux antiporter, putative (KEA2) Monovalent cation:proton antiporter family 2 (CPA2 family) member, PMID:11500563; similar to SWISS-PROT:SPP03819 Glutathione-regulated potassium-efflux system protein kefC (K(+)/H(+) antiporter) [Escherichia coli] Length = 627 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 212 IDRAHANYRAITNLKRQFPQLRVFL 286 +D ANYR + L + FP ++ F+ Sbjct: 500 LDTPGANYRCVWALSKYFPNVKTFV 524 >At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 492 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 45 KSSATMTARAISENLKHVCCLRTWSLLFRSAPIC 146 + T + I +L HV CLR+W ++ P C Sbjct: 296 REEMTNAKKLICGHLFHVHCLRSWLERQQTCPTC 329 >At2g38120.1 68415.m04679 amino acid permease, putative (AUX1) identical to AUX1 GI:1531758 from [Arabidopsis thaliana] Length = 485 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 108 RTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTLIG 221 RTW+ +F + CC I FH+ RIW+ +G Sbjct: 171 RTWTYIFGA---CCATT-----VFIPSFHNYRIWSFLG 200 >At2g21050.1 68415.m02499 amino acid permease, putative similar to AUX1 [Arabidopsis thaliana] GI:1531758; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 483 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 108 RTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTLIG 221 RTW+ +F + CC I FH+ RIW+ +G Sbjct: 165 RTWTYIFGA---CCATT-----VFIPSFHNYRIWSFLG 194 >At1g77690.1 68414.m09046 amino acid permease, putative similar to AUX1 (regulator of root gravitropism, putative permease) GI:1531758 GB:CAA67308 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 470 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 108 RTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTLIG 221 RTW+ +F + CC I FH+ RIW+ +G Sbjct: 169 RTWTYIFGA---CCATT-----VFIPSFHNYRIWSFLG 198 >At1g65040.2 68414.m07372 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 281 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 45 KSSATMTARAISENLKHVCCLRTWSLLFRSAPIC-CTNLPASKLT 176 + T + + +L HV CLR+W + P C +PA T Sbjct: 117 REEMTSAKKLVCGHLFHVHCLRSWLERQNTCPTCRALVVPAENAT 161 >At1g65040.1 68414.m07373 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 389 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 45 KSSATMTARAISENLKHVCCLRTWSLLFRSAPIC-CTNLPASKLT 176 + T + + +L HV CLR+W + P C +PA T Sbjct: 225 REEMTSAKKLVCGHLFHVHCLRSWLERQNTCPTCRALVVPAENAT 269 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,653,026 Number of Sequences: 28952 Number of extensions: 116419 Number of successful extensions: 399 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 321405440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -