BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B22 (457 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 23 6.7 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 6.7 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 22.6 bits (46), Expect = 6.7 Identities = 12/53 (22%), Positives = 23/53 (43%) Frame = +2 Query: 257 MEELDEAIKDPSTNPNYLPAITESYRYLKSTHEHGNKPENSIKVYVRAMDIST 415 ME+ I+ NPN + + R + H+ E+ +Y R + I++ Sbjct: 6 MEDAQYEIRHQVLNPNQRQQLEDRRRIKEQLHQLEQDNESPTHMYRRKLKIAS 58 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 22.6 bits (46), Expect = 6.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 310 QIIWICRWIFYSFVQFFHRPYRRSFRGNE 224 Q+IW R I Y+ R ++ +++G+E Sbjct: 431 QLIWNIRNIVYNQTSVTLRKHKAAYKGDE 459 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,728 Number of Sequences: 2352 Number of extensions: 7732 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -