BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B21 (416 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 3.4 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 23 3.4 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 22 7.8 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 239 KALGGSSVTNFMLYTRGRPQDWNKIAAD 322 KA+G + +LY QDW+ + A+ Sbjct: 1063 KAIGRRDTIHRILYQHKNKQDWSNLEAN 1090 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 23.4 bits (48), Expect = 3.4 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 152 TDYAWPYTMEHQPGVCLGSDEQRCYWPRGKALGGSSVTNFML 277 T + W + + G+D++R +L G++VT F+L Sbjct: 224 TIFLWIFWPSFNSALVDGADQERAIINTYLSLAGATVTTFVL 265 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 206 SDEQRCYWPRGKALGGSS 259 S +Q YWP G GGSS Sbjct: 472 SQQQSQYWPHGS--GGSS 487 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,139 Number of Sequences: 2352 Number of extensions: 9821 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34205040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -