BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B17 (422 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 0.70 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 0.70 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 0.70 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 0.70 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 219 PVIISTLLTLCSSYKMLLCLFSVAITTPLDAFMP 118 PV++S L+ +C Y C F+ +I P F+P Sbjct: 171 PVLLSGLIAMCGMYYRDECSFAESI-PPYLFFVP 203 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 0.70 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 219 PVIISTLLTLCSSYKMLLCLFSVAITTPLDAFMP 118 PV++S L+ +C Y C F+ +I P F+P Sbjct: 404 PVLLSGLIAMCGMYYRDECSFAESI-PPYLFFVP 436 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 0.70 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 219 PVIISTLLTLCSSYKMLLCLFSVAITTPLDAFMP 118 PV++S L+ +C Y C F+ +I P F+P Sbjct: 404 PVLLSGLIAMCGMYYRDECSFAESI-PPYLFFVP 436 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,443 Number of Sequences: 336 Number of extensions: 2341 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9384961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -