BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B16 (630 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 1.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 2.8 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 2.8 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 2.8 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 3.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +3 Query: 144 DEPLRLYKGNDISPAPTSGD----HPILPSIIDDIKLDP 248 DE R +KG D P SG+ + I P I D +L P Sbjct: 410 DERERYFKGLDEEKLPESGENIEINLIKPDIFDQWELGP 448 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 276 NEYCECT 256 NEYCECT Sbjct: 500 NEYCECT 506 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 73 ASYYQHTDLLRRGPSVFEDYGKLEMNH 153 A+YYQ+ ++L++ G E NH Sbjct: 416 AAYYQNENMLQKNAEYSGKVGYYENNH 442 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 73 ASYYQHTDLLRRGPSVFEDYGKLEMNH 153 A+YYQ+ ++L++ G E NH Sbjct: 364 AAYYQNENMLQKNAEYSGKVGYYENNH 390 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 210 ILPSIIDDIKLDPNRRYTRSIHS 278 +L +II+ L PNR Y H+ Sbjct: 342 VLGNIIESSILSPNRNYYGDFHN 364 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,361 Number of Sequences: 336 Number of extensions: 2627 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -