BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B16 (630 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023925-1|ABB36429.1| 434|Drosophila melanogaster RE75106p pro... 29 6.9 AY069604-1|AAL39749.1| 782|Drosophila melanogaster LD36415p pro... 29 6.9 AL031581-11|CAA20894.2| 1291|Drosophila melanogaster EG:115C2.10... 29 6.9 AE014298-85|AAF45537.1| 1300|Drosophila melanogaster CG13363-PA ... 29 6.9 AE014296-872|AAF47918.1| 434|Drosophila melanogaster CG11357-PA... 29 6.9 >BT023925-1|ABB36429.1| 434|Drosophila melanogaster RE75106p protein. Length = 434 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 243 DPNRRYTRSIHSHREKRSLSRNYYTSFPIHLPPFYP 350 DPN RS+H R KRS + ++ + FYP Sbjct: 262 DPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYP 297 >AY069604-1|AAL39749.1| 782|Drosophila melanogaster LD36415p protein. Length = 782 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 324 GKKYSNFSINFFFRDANEYCECTFC 250 G++ + F FF D+N YCEC C Sbjct: 358 GEEITCFYGEDFFGDSNRYCECETC 382 >AL031581-11|CAA20894.2| 1291|Drosophila melanogaster EG:115C2.10 protein. Length = 1291 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 324 GKKYSNFSINFFFRDANEYCECTFC 250 G++ + F FF D+N YCEC C Sbjct: 358 GEEITCFYGEDFFGDSNRYCECETC 382 >AE014298-85|AAF45537.1| 1300|Drosophila melanogaster CG13363-PA protein. Length = 1300 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 324 GKKYSNFSINFFFRDANEYCECTFC 250 G++ + F FF D+N YCEC C Sbjct: 358 GEEITCFYGEDFFGDSNRYCECETC 382 >AE014296-872|AAF47918.1| 434|Drosophila melanogaster CG11357-PA protein. Length = 434 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 243 DPNRRYTRSIHSHREKRSLSRNYYTSFPIHLPPFYP 350 DPN RS+H R KRS + ++ + FYP Sbjct: 262 DPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYP 297 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,281,904 Number of Sequences: 53049 Number of extensions: 442142 Number of successful extensions: 982 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2621070450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -