BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B15 (602 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 1.00 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 5.3 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 7.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 7.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.0 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 21 7.0 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 7.0 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 9.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.3 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.2 bits (50), Expect = 1.00 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 508 NGIVLNFRTHEPAYPRSWLCAFSFPSIYN 422 NG +L+ H+ W+C + IYN Sbjct: 361 NGNILSPSIHDNICSNGWICEHRWRQIYN 389 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 5.3 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -3 Query: 189 TLGLLSFLGHHSILEHQGHHLTLEDHLFQEHRVVLVLLFDHKRLLQVHL 43 T+G + + H + L E+ LF V L FD++ Q L Sbjct: 144 TMGQIREVARHFYHKELQIELVREEILFDTVHVTFKLTFDNRAFTQASL 192 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 84 PGPRGVPGIDG 116 PGP GVPG G Sbjct: 332 PGPPGVPGDHG 342 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 84 PGPRGVPGIDG 116 PGP GVPG G Sbjct: 332 PGPPGVPGDHG 342 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 LVRKDNQDLRVHKASKEYRVNEEKSVLLEEMAHL 294 ++ DN L + K +R+N E + EEM L Sbjct: 1062 MIPDDNTSLALPKNEGPFRLNVETAKTNEEMWEL 1095 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 72 DHKRLLQVHLYHLCSLV 22 DH + +YHLC++V Sbjct: 33 DHNGSIYWSMYHLCTVV 49 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 84 PGPRGVPGIDG 116 PGP GVPG G Sbjct: 271 PGPPGVPGDHG 281 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 520 SQKRNGIVLNFRTHEPAYPRSWLCAFSFPS 431 SQ + G+ R+ EP Y FSFP+ Sbjct: 594 SQIQRGVNAAIRSQEPFYITEPHQIFSFPA 623 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 9.3 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = -3 Query: 162 HHSILEHQGHHLTLEDHLFQEHRVVLVLLFDHKRLLQVHLYHLCSLVHQLN 10 + + L+H TL+D + RV + ++ + LQ L +++H L+ Sbjct: 295 YQAFLKHLNTEHTLDDRSTAQARVRMQVVSQLEIQLQKERDRLTAMMHHLH 345 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 115 PSIPGTPRGPG 83 P P PRGPG Sbjct: 393 PCTPSPPRGPG 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,606 Number of Sequences: 438 Number of extensions: 3918 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -