BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B14 (367 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0395 + 3118480-3119097,3119699-3119989,3120063-3120114,312... 29 1.5 11_04_0047 + 12787845-12788004,12788297-12788940 27 4.5 06_01_1116 + 9197761-9199956 27 6.0 10_08_0073 + 14657400-14657696,14658168-14658229,14658241-14658886 26 7.9 01_05_0402 + 21810906-21811831,21811875-21812472,21813119-21813391 26 7.9 >05_01_0395 + 3118480-3119097,3119699-3119989,3120063-3120114, 3120395-3120546 Length = 370 Score = 28.7 bits (61), Expect = 1.5 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -1 Query: 220 HCSDGWTSTYDCVSHSLANFLQFLEGIPRRRRNGPHSEDASDNQQNNFSEI 68 HCS G ++ V+ + FLQ L+ PRR + PH SD + + S + Sbjct: 194 HCSSGCINSL--VAEARIKFLQLLDHPPRRDQPPPHLCLGSDRARTHPSSL 242 >11_04_0047 + 12787845-12788004,12788297-12788940 Length = 267 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 295 LYKHEKIHKKVNE*LFSFSQSRGLGHCSDGWTSTYDC 185 L K+EK K+++ L S + LG S+ T+T DC Sbjct: 211 LAKYEKEKKQMSNSLPSDGDNTNLGASSESMTATVDC 247 >06_01_1116 + 9197761-9199956 Length = 731 Score = 26.6 bits (56), Expect = 6.0 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 163 SWP-ENERRSHKCWSSRRYSGPGHGFG*RKIII 258 SWP ENER KC +S H + +III Sbjct: 621 SWPMENERNKEKCNQEFHFSIEEHFYSSHQIII 653 >10_08_0073 + 14657400-14657696,14658168-14658229,14658241-14658886 Length = 334 Score = 26.2 bits (55), Expect = 7.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 136 RRRRNGPHSEDASDNQQN 83 RRRR PH ED D +N Sbjct: 120 RRRRRDPHREDDGDRHRN 137 >01_05_0402 + 21810906-21811831,21811875-21812472,21813119-21813391 Length = 598 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 109 RYGDRFGGAVESLLGIGESWPENERRSHKCWS 204 R+ GGA+ + L IG SWP SH W+ Sbjct: 135 RFSHLTGGAIVNSLTIGVSWPP----SHDLWN 162 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,415,896 Number of Sequences: 37544 Number of extensions: 172280 Number of successful extensions: 415 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -