BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B12 (576 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 1.9 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 5.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 5.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.5 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 1.9 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +3 Query: 306 AGTSSLWEGFSLIHIVANGKA-HGQDLGAPGSCLRKFSTMPYMFCNLNNVCDFAQREDYS 482 AG++ L L+ +A+G + +G P + L S+ P F ++ ++R+ Sbjct: 49 AGSNLLCASNGLVTTLASGSSLNGLTNNVPSNGLS--SSGP--FSSIGGGISASKRQRTD 104 Query: 483 FWLSTPEPMPMAMTPIP 533 WLS+P +TP P Sbjct: 105 DWLSSPSGNVPPLTPSP 121 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 61 NFPGIPLSPGRPSRPGKPVS 2 N P + SPG PS P +S Sbjct: 113 NVPPLTPSPGPPSHPYTVIS 132 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 4 KPVFQVLMAGQDLMECQES 60 K V+++G+DLM C ++ Sbjct: 186 KYAIPVILSGRDLMSCAQT 204 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 276 SQTRLIPQCPAGTSSLWEGFSLI 344 S + + P+CP+G S L E +L+ Sbjct: 90 SDSLVQPRCPSGESMLSERAALL 112 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 Query: 359 WESSWPRFRCPWQLLTQILNNAI 427 WE ++ CP L IL N I Sbjct: 720 WERKRRQYLCPVLLRVSILRNII 742 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,938 Number of Sequences: 336 Number of extensions: 2626 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -