BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B11 (460 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 3.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 3.7 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 260 NLKGADVTYSDGVLTVALG 316 N+KG DG+L +ALG Sbjct: 236 NIKGDTFDLMDGILGLALG 254 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 361 LLVWCLSVYNICAIRTKGNSQHPITVSYVST 269 +LV ++V IC +R KG+ V Y T Sbjct: 1595 ILVIIVAVIVICVLRGKGHGSDKDDVVYQQT 1625 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,934 Number of Sequences: 438 Number of extensions: 2649 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -