BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B05 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.16 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 2.0 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.6 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 3.4 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 3.4 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 3.4 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 3.4 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 4.5 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 6.0 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 6.0 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 6.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.16 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 480 TSTLSVPEWTTCSRTRLVHLRPPFTPISLIVMTTLW 587 +ST + P WTT + R RP T + TT W Sbjct: 1044 SSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNW 1079 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 519 RTRLVHLRPPFTPISLIVM 575 R H +PP++ ISLI M Sbjct: 133 RRSYTHAKPPYSYISLITM 151 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 2.6 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = +2 Query: 50 LLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGN 229 +L +N+ E P + E QP Q S + + T +S K P +GN Sbjct: 378 ILNAINAALKSDEIPPEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKPQTTKTPESGN 437 Query: 230 EN 235 E+ Sbjct: 438 ES 439 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 136 GQLQGAPASGCTNCQL 183 G LQG P SGC C+L Sbjct: 305 GLLQGDPLSGCL-CEL 319 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 483 STLSVPEWTTCSRTRLVHLRPPFTP 557 ++ SVPE T + R RPP TP Sbjct: 395 NSYSVPEPTISTTPRPEWARPPSTP 419 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/44 (18%), Positives = 21/44 (47%) Frame = -1 Query: 526 LVLEHVVHSGTDSVEVRNLRNIWQVFSGECFGTEIVVVVMEEIY 395 L LEH +++ +++ + V EC+ ++ + +I+ Sbjct: 235 LFLEHYEVINRQTLDTADVKTLTTVVEKECYKMKVTIDAFNDIF 278 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/44 (18%), Positives = 21/44 (47%) Frame = -1 Query: 526 LVLEHVVHSGTDSVEVRNLRNIWQVFSGECFGTEIVVVVMEEIY 395 L LEH +++ +++ + V EC+ ++ + +I+ Sbjct: 161 LFLEHYEVINRQTLDTADVKTLTTVVEKECYKMKVTIDAFNDIF 204 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 383 AAGKVNLFHNDNHDFSAKAFATKNLPNI 466 AA K+N FH D + F ++LP++ Sbjct: 235 AASKLNSFHWHITDSHSFPFTAESLPDL 262 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 322 ERTRSDPHKNSYPWV 366 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 322 ERTRSDPHKNSYPWV 366 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 322 ERTRSDPHKNSYPWV 366 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,131 Number of Sequences: 336 Number of extensions: 3201 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -