BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B04 (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 25 2.0 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 25 2.0 AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 24 2.6 AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-tran... 24 2.6 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 24 2.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 2.6 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 24 3.5 AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 24 3.5 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 23 4.6 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 23 8.1 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 8.1 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 36 LLVGVNSRYVLVEEPGYYIEQYDDQPEQW 122 +LVG+ + VL E GY+ + PE+W Sbjct: 411 ILVGMG-QLVLQREEGYFTRPSEFMPERW 438 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 272 QLHLVSEINGAKSTELVVFVAS 207 QL EINGA +TEL F+ + Sbjct: 195 QLPYYEEINGAGATELAEFIVN 216 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 55 AGTCSLKSLATTSNSMMISRSSGATPGCAGKRVLSLSTL 171 AG C + L ++ ++ S+ A P C+ K++ S+ L Sbjct: 48 AGECMISFLPKYEHTHVMQLSTSAIPCCSPKKMNSIRLL 86 >AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 272 QLHLVSEINGAKSTELVVFV 213 QL EINGA +TEL F+ Sbjct: 195 QLPYYEEINGAGATELAEFI 214 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 24.2 bits (50), Expect = 2.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 410 PQRKGFRY*EHAQHSSSSR-FQHCWWRIGLH 499 PQ + +H H SR F HC R+G H Sbjct: 219 PQPQWLEEDQHVFHVVKSRNFDHCEQRMGFH 249 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.2 bits (50), Expect = 2.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 410 PQRKGFRY*EHAQHSSSSR-FQHCWWRIGLH 499 PQ + +H H SR F HC R+G H Sbjct: 219 PQPQWLEEDQHVFHVVKSRNFDHCEQRMGFH 249 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 244 EPRALSLWFSLPVIGTLTIAPEVPSE 167 EPRAL + + + TLT+ P V S+ Sbjct: 6 EPRALGIVLAFLSVLTLTLLPPVSSQ 31 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -2 Query: 190 IAPEV-PSELIVRAPACRRTLELPHC 116 IA +V P EL+V PA R + +P+C Sbjct: 163 IAHDVDPIELVVYLPALCRKMGVPYC 188 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 6 MFTKLFLVSVLLVGVNSRYVLVEEPGYYIEQYD 104 M+ K F ++LL+ S+YV ++P + YD Sbjct: 1 MWCKQFAGALLLLVATSQYVQSQQPSKVLCYYD 33 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 22.6 bits (46), Expect = 8.1 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +3 Query: 60 YVLVEEPGYYIEQYDDQPEQWGNSRVRRQAGALTINSDGTSGAI 191 Y+L P Y+ E +PE++ + +R A S G+ I Sbjct: 14 YMLHHNPEYFPEPDQFRPERFADGETKRNPFAYIPFSAGSRNCI 57 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -2 Query: 451 MLGMFLVAKAFALRSWLSLWNRLTLPAAVSLSPKP 347 +L M + F W WNR T A+ P P Sbjct: 344 LLSMGISFPIFFPTYWPHYWNRFTQSTAMHNQPPP 378 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,632 Number of Sequences: 2352 Number of extensions: 12666 Number of successful extensions: 67 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -