BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B02 (413 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 23 3.3 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 23 3.3 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 4.4 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 4.4 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 5.8 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.4 bits (48), Expect = 3.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 309 GVAKTPSTATRPNGLNWRRS 368 GVA P AT P G W+ + Sbjct: 335 GVAFFPDAATNPGGKPWKNN 354 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.4 bits (48), Expect = 3.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 309 GVAKTPSTATRPNGLNWRRS 368 GVA P AT P G W+ + Sbjct: 335 GVAFFPDAATNPGGKPWKNN 354 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.0 bits (47), Expect = 4.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 251 VGLFVFYKSILLLWQPPFLR 192 VGLF F +LL+ P F R Sbjct: 72 VGLFFFRDPVLLVLSPEFAR 91 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 4.4 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 300 TNSGVA-KTPSTATRPNGLNWRRSEHNTYHSSPSNYKV 410 T SG KTP++ T P+G H+++ P KV Sbjct: 365 TPSGTEPKTPTSPTGPSGPGSGHRSHDSFVLFPRKVKV 402 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 22.6 bits (46), Expect = 5.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 270 IWTKK*TSTVTNSGVAKTPSTATRPN 347 +WT T+T T+ A P+T+ P+ Sbjct: 255 VWTDPTTTTTTDYTTAYPPTTSEPPS 280 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 336,356 Number of Sequences: 2352 Number of extensions: 4935 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -