BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_B02 (413 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 1.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 1.8 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 1.8 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 5.5 AB264336-1|BAF44091.1| 21|Apis mellifera ecdysone-induced prot... 21 5.5 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 7.3 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.3 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 7.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 20 9.6 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 20 9.6 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 55 ENEFSKTKSIFCTSNY*YKN 114 E E SK I ++NY YKN Sbjct: 294 ERERSKETKIISSNNYNYKN 313 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 55 ENEFSKTKSIFCTSNY*YKN 114 E E SK I ++NY YKN Sbjct: 305 ERERSKETKIISSNNYNYKN 324 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 1.8 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 376 LCSL-LLQFSPFGLVAVEGVFATPELVT 296 +C L +L ++P+G++++ G F L+T Sbjct: 279 ICFLYVLSWTPYGVMSMIGAFGNKALLT 306 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 327 STATRPNGLNWRRSEHNTYHSSPSNY 404 S T N N+ + +N Y+ + +NY Sbjct: 86 SNKTIHNNNNYNNNNYNNYNYNNNNY 111 >AB264336-1|BAF44091.1| 21|Apis mellifera ecdysone-induced protein 75 protein. Length = 21 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 245 DQLPDLKPHLDKEINFHS 298 D+LP LK L+ +N+H+ Sbjct: 3 DELPILKGILNGVVNYHN 20 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 20.6 bits (41), Expect = 7.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 233 YKSILLLWQPP 201 Y S L++WQPP Sbjct: 136 YYSGLVVWQPP 146 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 7.3 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +3 Query: 351 LNWRRSEHN 377 LN+R+SEHN Sbjct: 403 LNFRKSEHN 411 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.6 bits (41), Expect = 7.3 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +3 Query: 354 NWRRSEHNTYHSSPSNY 404 N++ S +N Y+++ +NY Sbjct: 321 NYKYSNYNNYNNNYNNY 337 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 7.3 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +3 Query: 351 LNWRRSEHN 377 LN+R+SEHN Sbjct: 493 LNFRKSEHN 501 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 20.2 bits (40), Expect = 9.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 363 RSEHNTYHSSPSNY 404 R H+T H S NY Sbjct: 194 RQRHSTIHLSTGNY 207 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.6 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = +3 Query: 315 AKTPSTATRPNGLNWRRSEHNTYHSSPSNYKVS 413 +K P + N L+ + +N Y++ +NY + Sbjct: 76 SKEPKIISNNNSLSNNYNYNNNYNNYNNNYNTN 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,607 Number of Sequences: 438 Number of extensions: 1661 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10503195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -