BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A23 (112 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09850.1 68414.m01109 cysteine protease, papain-like (XBCP3) ... 34 0.015 At3g48340.1 68416.m05276 cysteine proteinase, putative similar t... 31 0.11 At3g48350.1 68416.m05277 cysteine proteinase, putative similar t... 30 0.25 At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol pro... 30 0.25 At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 29 0.44 At2g22160.1 68415.m02632 cysteine endopeptidase-related similar ... 29 0.44 At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XC... 29 0.44 At4g11310.1 68417.m01827 cysteine proteinase, putative contains ... 28 0.76 At3g54940.3 68416.m06091 cysteine proteinase, putative contains ... 28 0.76 At3g54940.2 68416.m06090 cysteine proteinase, putative contains ... 28 0.76 At3g54940.1 68416.m06089 cysteine proteinase, putative contains ... 28 0.76 At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG1... 27 1.3 At4g11320.1 68417.m01828 cysteine proteinase, putative contains ... 27 1.3 At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XC... 27 2.3 At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XC... 27 2.3 At1g06260.1 68414.m00662 cysteine proteinase, putative contains ... 27 2.3 At3g43960.1 68416.m04706 cysteine proteinase, putative contains ... 26 3.1 At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse... 26 3.1 At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse... 26 3.1 At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p... 26 3.1 At4g36880.1 68417.m05229 cysteine proteinase, putative strong si... 25 5.4 At1g71020.1 68414.m08197 armadillo/beta-catenin repeat family pr... 25 7.1 At3g45310.1 68416.m04892 cysteine proteinase, putative similar t... 25 9.4 >At1g09850.1 68414.m01109 cysteine protease, papain-like (XBCP3) identical to papain-like cysteine peptidase XBCP3 GI:14600257 from [Arabidopsis thaliana]; contains Pfam profiles PF00112: Papain family cysteine protease and PF00396: Granulin Length = 437 Score = 33.9 bits (74), Expect = 0.015 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 45 LAAHVTYPDQVDWRKKGSVTEV 110 L V PD VDWRKKG+VT V Sbjct: 112 LGGSVKVPDSVDWRKKGAVTNV 133 >At3g48340.1 68416.m05276 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 351 Score = 31.1 bits (67), Expect = 0.11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWRKKG+VTE+ Sbjct: 129 PSSVDWRKKGAVTEI 143 >At3g48350.1 68416.m05277 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 364 Score = 29.9 bits (64), Expect = 0.25 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWR+KG+VTEV Sbjct: 127 PSSVDWREKGAVTEV 141 >At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol protease identical to SP|P43297 Cysteine proteinase RD21A precursor (EC 3.4.22.-) {Arabidopsis thaliana}, thiol protease RD21A SP:P43297 from [Arabidopsis thaliana] Length = 462 Score = 29.9 bits (64), Expect = 0.25 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P+ +DWRKKG+V EV Sbjct: 138 PESIDWRKKGAVAEV 152 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 29.1 bits (62), Expect = 0.44 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 PD VDWRK+G+V +V Sbjct: 139 PDSVDWRKEGAVADV 153 >At2g22160.1 68415.m02632 cysteine endopeptidase-related similar to cysteine endopeptidase precursor GI:2944446 from [Ricinus communis] Length = 105 Score = 29.1 bits (62), Expect = 0.44 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 PD +DWR+KG+VT V Sbjct: 80 PDSLDWREKGAVTNV 94 >At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XCP2) identical to papain-type cysteine endopeptidase XCP2 GI:6708183 from [Arabidopsis thaliana] Length = 356 Score = 29.1 bits (62), Expect = 0.44 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWRKKG+V EV Sbjct: 139 PKSVDWRKKGAVAEV 153 >At4g11310.1 68417.m01827 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 364 Score = 28.3 bits (60), Expect = 0.76 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 21 MCAVPRSYLAAHVTYPDQVDWRKKGSVTEV 110 M + R +A P VDWR +G+VTEV Sbjct: 123 MTSSDRYKTSADDVLPKSVDWRNEGAVTEV 152 >At3g54940.3 68416.m06091 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 368 Score = 28.3 bits (60), Expect = 0.76 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P+ DWR+KG VTEV Sbjct: 138 PEDFDWREKGGVTEV 152 >At3g54940.2 68416.m06090 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 211 Score = 28.3 bits (60), Expect = 0.76 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P+ DWR+KG VTEV Sbjct: 138 PEDFDWREKGGVTEV 152 >At3g54940.1 68416.m06089 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 166 Score = 28.3 bits (60), Expect = 0.76 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P+ DWR+KG VTEV Sbjct: 138 PEDFDWREKGGVTEV 152 >At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG12) / cysteine proteinase, putative identical to senescence-specific protein SAG12 GI:1046373 from [Arabidopsis thaliana] Length = 346 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWRKKG+VT + Sbjct: 131 PVSVDWRKKGAVTPI 145 >At4g11320.1 68417.m01828 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 371 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWR +G+VTEV Sbjct: 145 PKSVDWRNEGAVTEV 159 >At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 288 Score = 26.6 bits (56), Expect = 2.3 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWRKKG+V V Sbjct: 138 PKSVDWRKKGAVAPV 152 >At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 355 Score = 26.6 bits (56), Expect = 2.3 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P VDWRKKG+V V Sbjct: 138 PKSVDWRKKGAVAPV 152 >At1g06260.1 68414.m00662 cysteine proteinase, putative contains similarity to thiol-protease, pre-pro-TPE4A protein GI:3688528 [Pisum sativum] Length = 343 Score = 26.6 bits (56), Expect = 2.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 PD VDWR +G+VT + Sbjct: 128 PDAVDWRTQGAVTPI 142 >At3g43960.1 68416.m04706 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 376 Score = 26.2 bits (55), Expect = 3.1 Identities = 8/12 (66%), Positives = 12/12 (100%) Frame = +3 Query: 66 PDQVDWRKKGSV 101 PD+VDWR++G+V Sbjct: 128 PDEVDWRERGAV 139 >At3g19400.2 68416.m02460 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 290 Score = 26.2 bits (55), Expect = 3.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 PD+VDWR G+V V Sbjct: 131 PDEVDWRANGAVVSV 145 >At3g19400.1 68416.m02461 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 362 Score = 26.2 bits (55), Expect = 3.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 PD+VDWR G+V V Sbjct: 131 PDEVDWRANGAVVSV 145 >At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol protease, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 452 Score = 26.2 bits (55), Expect = 3.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 PD +DWR KG+V V Sbjct: 130 PDAIDWRAKGAVNPV 144 >At4g36880.1 68417.m05229 cysteine proteinase, putative strong similarity to cysteine proteinase COT44 precursor SP:P25251 from [Brassica napus] (Rape) Length = 376 Score = 25.4 bits (53), Expect = 5.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 66 PDQVDWRKKGSVTEV 110 P+ VDWR+KG+V + Sbjct: 146 PETVDWRQKGAVNPI 160 >At1g71020.1 68414.m08197 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 628 Score = 25.0 bits (52), Expect = 7.1 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 98 GALLAPVDLVRVGDVRGQ 45 GA++A VDL++ G VRG+ Sbjct: 466 GAIMALVDLLQYGSVRGK 483 >At3g45310.1 68416.m04892 cysteine proteinase, putative similar to AALP protein GI:7230640 from [Arabidopsis thaliana] and barley aleurain Length = 358 Score = 24.6 bits (51), Expect = 9.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 39 SYLAAHVTYPDQVDWRKKGSVTEV 110 S+ T PD DWR+ G V+ V Sbjct: 133 SHKITEATVPDTKDWREDGIVSPV 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,153,159 Number of Sequences: 28952 Number of extensions: 21293 Number of successful extensions: 80 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 12,070,560 effective HSP length: 17 effective length of database: 11,578,376 effective search space used: 219989144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -