BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A22 (311 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1A10.02 |||chromosome segregation protein |Schizosaccharomy... 23 8.1 SPAC24C9.05c |mug70||conserved protein |Schizosaccharomyces pomb... 23 8.1 >SPAPB1A10.02 |||chromosome segregation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 336 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 132 DESLMSNWVCLVENESGRFTDKIG 203 D S + CL+ N SG TD+ G Sbjct: 194 DASALEKKSCLLPNSSGTLTDQRG 217 >SPAC24C9.05c |mug70||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 730 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 105 VQELRRQGF--DESLMSNWVCLVENESGRFTDKIGKVTKNG 221 V + R++ + DE+L + + +SG F + K+ +NG Sbjct: 20 VSDTRKRQYQRDEALRKKIISELGKKSGNFESPVRKIRRNG 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,256,375 Number of Sequences: 5004 Number of extensions: 21118 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 81889040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -