BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A22 (311 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase fa... 29 0.66 At2g47160.1 68415.m05889 anion exchange family protein contains ... 29 0.87 At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase fa... 29 0.87 At3g62270.1 68416.m06996 anion exchange family protein contains ... 27 2.0 At4g24640.1 68417.m03528 invertase/pectin methylesterase inhibit... 26 4.6 At4g11980.1 68417.m01907 MutT/nudix family protein low similarit... 26 4.6 At2g44090.1 68415.m05483 expressed protein 25 8.1 >At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase family protein simlar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 585 Score = 29.1 bits (62), Expect = 0.66 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +3 Query: 144 MSNWVCLVENESGRFTDKIGKVTKNGSRDYGLFQINDKYWCSTGSTPGKDCH 299 M NW L+EN+ R K G V K + F KY ++ G D H Sbjct: 451 MQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSRNSDRYSGDDLH 502 >At2g47160.1 68415.m05889 anion exchange family protein contains some similarity to SWISS-PROT:P04919 anion transport protein (anion exchange protein 1) [Mouse] {Mus musculus} Length = 704 Score = 28.7 bits (61), Expect = 0.87 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -3 Query: 174 RSRQGRP-SYSSNFHRSLV--F*APALIRIW*NVSHRNAKRVPKG 49 RSR+ R Y + + RSL+ + P ++ +W VS+ A VPKG Sbjct: 217 RSRKARSWRYGTGWLRSLIADYGVPLMVLVWTGVSYIPAGDVPKG 261 >At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 594 Score = 28.7 bits (61), Expect = 0.87 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +3 Query: 144 MSNWVCLVENESGRFTDKIGKVTKNGSRDYGLFQINDKYWCSTGSTPGKDCH 299 M NW L+EN+ R K G V K + F KY ++ G D H Sbjct: 460 MQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSNNSDRYAGGDLH 511 >At3g62270.1 68416.m06996 anion exchange family protein contains similarity to anion exchanger 3, cardiac splice form - Rattus norvegicus, PIR:A42497 Length = 703 Score = 27.5 bits (58), Expect = 2.0 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -3 Query: 174 RSRQGRP-SYSSNFHRSLV--F*APALIRIW*NVSHRNAKRVPKG 49 RSR+ R Y + + RSLV + P ++ +W VS+ VPKG Sbjct: 217 RSRKARSWRYGTGWLRSLVADYGVPLMVLVWTGVSYIPTGDVPKG 261 >At4g24640.1 68417.m03528 invertase/pectin methylesterase inhibitor family protein annotation temporarily based on supporting cDNA gi|4097527|gb|U63898.1|U63898 Length = 187 Score = 26.2 bits (55), Expect = 4.6 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -1 Query: 299 VAILSRSGPGAAPVFVIDLEEAVVSRSVLSHFTNFVGKPSAFVLD--KADPVTHQTFIE 129 V L+ + P AAP+ ++ L EAV++ ++ SH K + FV + K DP F E Sbjct: 47 VKTLTTNPPTAAPIGLLPLSEAVINLAI-SH----AEKTAIFVDETAKKDPTVKVAFTE 100 >At4g11980.1 68417.m01907 MutT/nudix family protein low similarity to SP|P54570 ADP-ribose pyrophosphatase (EC 3.6.1.13) {Bacillus subtilis}; contains Pfam profile PF00293: NUDIX domain Length = 309 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 120 RQGFDESLMSNWVCLVENESGRFTD 194 R D SL NW+ +E+ESG D Sbjct: 71 RDAIDSSLFRNWLRNLESESGILAD 95 >At2g44090.1 68415.m05483 expressed protein Length = 582 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 138 SLMSNWVCLVENESGRFTDKIGKVTKNGSRDY 233 SL S W E+E T+ I K+ +G++DY Sbjct: 103 SLDSIWFLSTEHELRGITELIAKIICHGAQDY 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,651,732 Number of Sequences: 28952 Number of extensions: 112370 Number of successful extensions: 273 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 331449360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -