BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A21 (225 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X76091-1|CAA53705.1| 723|Homo sapiens DNA binding protein RFX2 ... 28 4.7 BC071571-1|AAH71571.1| 723|Homo sapiens RFX2 protein protein. 28 4.7 BC028579-1|AAH28579.1| 723|Homo sapiens regulatory factor X, 2 ... 28 4.7 >X76091-1|CAA53705.1| 723|Homo sapiens DNA binding protein RFX2 protein. Length = 723 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 11 RSHGLHQS*RLLPGRKTESLQDSDHIAGLQRRLEE 115 R +HQ R P +KT+SL DS +GL E+ Sbjct: 291 RQQPMHQKPRYRPAQKTDSLGDSGSHSGLHSTPEQ 325 >BC071571-1|AAH71571.1| 723|Homo sapiens RFX2 protein protein. Length = 723 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 11 RSHGLHQS*RLLPGRKTESLQDSDHIAGLQRRLEE 115 R +HQ R P +KT+SL DS +GL E+ Sbjct: 291 RQQPMHQKPRYRPAQKTDSLGDSGSHSGLHSTPEQ 325 >BC028579-1|AAH28579.1| 723|Homo sapiens regulatory factor X, 2 (influences HLA class II expression) protein. Length = 723 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 11 RSHGLHQS*RLLPGRKTESLQDSDHIAGLQRRLEE 115 R +HQ R P +KT+SL DS +GL E+ Sbjct: 291 RQQPMHQKPRYRPAQKTDSLGDSGSHSGLHSTPEQ 325 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,686,688 Number of Sequences: 237096 Number of extensions: 474001 Number of successful extensions: 997 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 76,859,062 effective HSP length: 53 effective length of database: 64,292,974 effective search space used: 1350152454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -