BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A20 (275 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.027 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.036 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.047 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.062 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.082 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.082 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.082 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.082 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 32 0.082 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 31 0.14 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.14 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.14 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.14 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 31 0.19 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 31 0.19 SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 30 0.33 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 29 0.44 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 0.44 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 29 0.58 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 29 0.77 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 29 0.77 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 29 0.77 SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 0.77 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 29 0.77 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 28 1.0 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 1.0 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 28 1.0 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 1.0 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 28 1.0 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.0 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 28 1.0 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_28078| Best HMM Match : SGS (HMM E-Value=1.5) 28 1.3 SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) 28 1.3 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 28 1.3 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 28 1.3 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 27 1.8 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 27 1.8 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_3220| Best HMM Match : Ion_trans (HMM E-Value=5.6e-22) 27 1.8 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) 27 2.3 SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) 27 2.3 SB_37320| Best HMM Match : GP46 (HMM E-Value=5) 27 2.3 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_28194| Best HMM Match : ResIII (HMM E-Value=0.72) 27 2.3 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) 27 2.3 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_8959| Best HMM Match : PAN (HMM E-Value=0.013) 27 2.3 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 27 2.3 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) 27 2.3 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 27 2.3 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_43215| Best HMM Match : ResIII (HMM E-Value=7.9) 27 2.3 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_35990| Best HMM Match : ResIII (HMM E-Value=2) 27 2.3 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 27 2.3 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) 27 2.3 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 27 2.3 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) 27 2.3 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 27 3.1 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 27 3.1 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_15828| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_14370| Best HMM Match : MyTH4 (HMM E-Value=9.3e-25) 27 3.1 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 27 3.1 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 27 3.1 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 27 3.1 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 27 3.1 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 27 3.1 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_38124| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 27 3.1 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_12870| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 27 3.1 SB_5337| Best HMM Match : ResIII (HMM E-Value=2.4) 27 3.1 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 3.1 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 27 3.1 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 26 4.1 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 26 4.1 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 26 4.1 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 26 4.1 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 26 4.1 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 26 4.1 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 26 4.1 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 26 4.1 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 26 4.1 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 26 4.1 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 26 4.1 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 26 4.1 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 26 4.1 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 26 4.1 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 26 4.1 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 26 4.1 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 26 4.1 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 26 4.1 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 26 4.1 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 26 4.1 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 26 4.1 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 26 4.1 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 26 4.1 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 26 4.1 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 26 4.1 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 26 4.1 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 26 4.1 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 26 4.1 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 26 4.1 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_11649| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 26 4.1 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 26 4.1 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 26 4.1 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 26 4.1 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 26 4.1 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 >SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.027 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -1 Query: 107 HLGNRHVPRADSCSPGDPLV*S-AATRWS 24 HLG RH+ ++SCSPGDPLV RWS Sbjct: 9 HLG-RHLTGSNSCSPGDPLVLERPPPRWS 36 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.036 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 HVP ++SCSPGDPLV RWS Sbjct: 14 HVPPSNSCSPGDPLVLERPPPRWS 37 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.047 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 47 KLVDPPGCRNRHEARVCCQD-GSYKEARRKERPVTP 151 +LVDPPGCRN + +D S++ A+R +PV P Sbjct: 14 ELVDPPGCRNSIKVHKDVKDKPSHQGAQRLGKPVVP 49 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 32.3 bits (70), Expect = 0.062 Identities = 16/26 (61%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N H ++SCSPGDPLV AA RWS Sbjct: 49 NVHFIPSNSCSPGDPLVLERAAPRWS 74 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.9 bits (69), Expect = 0.082 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -1 Query: 104 LGNRHVPRADSCSPGDPLV*S-AATRWS 24 L N+H ++SCSPGDPLV RWS Sbjct: 56 LRNKHTNPSNSCSPGDPLVLERPPPRWS 83 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.082 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G+RH P ++SCSPGDPLV RWS Sbjct: 9 GSRHEP-SNSCSPGDPLVLERPPPRWS 34 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.082 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 NR+ R++SCSPGDPLV RWS Sbjct: 2 NRYYYRSNSCSPGDPLVLERPPPRWS 27 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.082 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 134 LCDGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 L + +C+CH HV ++SCSPGDPLV RWS Sbjct: 13 LIESPICDCHA---HV--SNSCSPGDPLVLERPPPRWS 45 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 31.9 bits (69), Expect = 0.082 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H+P ++SCSPGDPLV RWS Sbjct: 136 HLPGSNSCSPGDPLVLERPPPRWS 159 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 0.11 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 95 RHVPRADSCSPGDPLV*S-AATRWS 24 R VP ++SCSPGDPLV RWS Sbjct: 6 RPVPASNSCSPGDPLVLERPPPRWS 30 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.11 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 +PR++SCSPGDPLV RWS Sbjct: 1 MPRSNSCSPGDPLVLERPPPRWS 23 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.11 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -1 Query: 122 LLCNCHL----GNRHVPRADSCSPGDPLV*S-AATRWS 24 L CN L R P+++SCSPGDPLV RWS Sbjct: 14 LYCNKQLVIIRATRRKPQSNSCSPGDPLVLERPPPRWS 51 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 31.1 bits (67), Expect = 0.14 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 110 CHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 C++ N H ++SCSPGDPLV RWS Sbjct: 6 CNIANSHT--SNSCSPGDPLVLERPPPRWS 33 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.1 bits (67), Expect = 0.14 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 PR++SCSPGDPLV RWS Sbjct: 21 PRSNSCSPGDPLVLERPPPRWS 42 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.1 bits (67), Expect = 0.14 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 PR++SCSPGDPLV RWS Sbjct: 68 PRSNSCSPGDPLVLERPPPRWS 89 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 0.14 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 PR++SCSPGDPLV RWS Sbjct: 16 PRSNSCSPGDPLVLERPPPRWS 37 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 0.19 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 119 LCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 +C C + R +++SCSPGDPLV RWS Sbjct: 1 MCLCRMKTRE--KSNSCSPGDPLVLERPPPRWS 31 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 30.7 bits (66), Expect = 0.19 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G +P ++SCSPGDPLV RWS Sbjct: 177 GTTTIPPSNSCSPGDPLVLERPPPRWS 203 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 30.7 bits (66), Expect = 0.19 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 47 KLVDPPGCRNR-HEARVCCQDGSYKEARRKERP 142 +LVDPPGCRN HEA G+++ R P Sbjct: 14 ELVDPPGCRNSIHEAAALDGAGTFQRFRNVTIP 46 >SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.7 bits (66), Expect = 0.19 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -1 Query: 131 CDGLLCNCHLGNRH-VPRADSCSPGDPLV*S-AATRWS 24 C C C+ N + VP+A SPGDPLV RWS Sbjct: 4 CGSYRCRCNRINPNGVPKASQHSPGDPLVLERPPPRWS 41 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 0.19 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 95 RHVPRADSCSPGDPLV*S-AATRWS 24 +HV ++SCSPGDPLV RWS Sbjct: 20 QHVAASNSCSPGDPLVLERPPPRWS 44 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 0.19 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G+R + ++SCSPGDPLV RWS Sbjct: 9 GSRRLQTSNSCSPGDPLVLERPPPRWS 35 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.7 bits (66), Expect = 0.19 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 47 KLVDPPGCRNRHEARVCCQDGSYK 118 +LVDPPGCRN + +V DG+ K Sbjct: 14 ELVDPPGCRNSMKMKVESIDGAEK 37 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 30.3 bits (65), Expect = 0.25 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 80 ADSCSPGDPLV*SAATRWSYRLVPFS 3 ++SCSPGDPLV A+ W P+S Sbjct: 8 SNSCSPGDPLVLERASPWWSSNSPYS 33 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 0.25 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 NR V ++SCSPGDPLV RWS Sbjct: 8 NRCVTSSNSCSPGDPLVLERPPPRWS 33 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 0.25 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N +P ++SCSPGDPLV RWS Sbjct: 12 NIDIPLSNSCSPGDPLVLERPPPRWS 37 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 0.25 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV A RWS Sbjct: 15 RSNSCSPGDPLVLERAPPRWS 35 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 0.25 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 143 LAFLCDGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 L F C L N R ++SCSPGDPLV RWS Sbjct: 5 LVFRCGHLTTNAATRVRFPLISNSCSPGDPLVLERPPPRWS 45 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 0.25 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 ++H +++SCSPGDPLV RWS Sbjct: 13 SKHKAKSNSCSPGDPLVLERPPPRWS 38 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.3 bits (65), Expect = 0.25 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 2 H*REQGGSSTGWRRSKLVDPPGCRNRHEARV 94 H R S+ +LVDPPGCRN ++RV Sbjct: 62 HYRANWSSTAVAAALELVDPPGCRNSMDSRV 92 >SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 0.33 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 113 NCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 +CH + ++SCSPGDPLV RWS Sbjct: 12 SCHYRSHGTYGSNSCSPGDPLVLERPPPRWS 42 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.9 bits (64), Expect = 0.33 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 95 RHVPRADSCSPGDPLV*S-AATRWS 24 R + R++SCSPGDPLV RWS Sbjct: 25 RSLQRSNSCSPGDPLVLERPPPRWS 49 >SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 0.33 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 108 PSWQQTRASCRFLQPGGSTS 49 P WQ T+ FLQPGGSTS Sbjct: 5 PGWQSTKI-IEFLQPGGSTS 23 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.9 bits (64), Expect = 0.33 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G+ P ++SCSPGDPLV RWS Sbjct: 66 GSNWYPPSNSCSPGDPLVLERPPPRWS 92 >SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) Length = 670 Score = 29.9 bits (64), Expect = 0.33 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 105 SWQQTRASCRFLQPGGSTS 49 SWQ + FLQPGGSTS Sbjct: 220 SWQNPTKTIEFLQPGGSTS 238 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 29.5 bits (63), Expect = 0.44 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -1 Query: 131 CDGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 C+ +L C L +VP ++SCSPGDPLV RWS Sbjct: 28 CNKMLGLC-LKQANVP-SNSCSPGDPLVLERPPPRWS 62 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 29.5 bits (63), Expect = 0.44 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V R++SCSPGDPLV RWS Sbjct: 873 VKRSNSCSPGDPLVLERPPPRWS 895 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.5 bits (63), Expect = 0.44 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 +R V ++SCSPGDPLV RWS Sbjct: 75 SREVATSNSCSPGDPLVLERPPPRWS 100 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 29.5 bits (63), Expect = 0.44 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 2 H*REQGGSSTGWRRSKLVDPPGCRNRHEARVCCQD 106 H R S+ +LVDPPGCRN +VC +D Sbjct: 54 HYRANWSSTAVAAALELVDPPGCRN--SMKVCVKD 86 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 0.44 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N R++SCSPGDPLV RWS Sbjct: 21 NSKATRSNSCSPGDPLVLERPPPRWS 46 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.5 bits (63), Expect = 0.44 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N H ++SCSPGDPLV RWS Sbjct: 3 NLHCSLSNSCSPGDPLVLERPPPRWS 28 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 0.58 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 122 LLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 L+C R ++SCSPGDPLV RWS Sbjct: 7 LMCRASRKTRKKIPSNSCSPGDPLVLERPPPRWS 40 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 0.58 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 125 GLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 G+ +G R P ++SCSPGDPLV RWS Sbjct: 3 GVSVESRVGVR-TPTSNSCSPGDPLVLERPPPRWS 36 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 95 RHVPRADSCSPGDPLV*S-AATRWS 24 +H+P ++SCSPGDPLV RWS Sbjct: 25 KHLP-SNSCSPGDPLVLERPPPRWS 48 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V R++SCSPGDPLV RWS Sbjct: 23 VRRSNSCSPGDPLVLERPPPRWS 45 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N P ++SCSPGDPLV RWS Sbjct: 35 NPRKPPSNSCSPGDPLVLERPPPRWS 60 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 110 CHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 C G + ++SCSPGDPLV RWS Sbjct: 18 CQGGGAYGKTSNSCSPGDPLVLERPPPRWS 47 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 0.58 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 47 KLVDPPGCRNRHEAR 91 +LVDPPGCRN +AR Sbjct: 14 ELVDPPGCRNSIQAR 28 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 95 RHVPRADSCSPGDPLV*S-AATRWS 24 RH ++SCSPGDPLV RWS Sbjct: 4 RHNVTSNSCSPGDPLVLERPPPRWS 28 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 29.1 bits (62), Expect = 0.58 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -1 Query: 164 LTSLLV*LAFLCDGLLCN-CHLGNRHVPRA-DSCSPGDPLV*S-AATRWS 24 L L + +A L L + C NR + A +SCSPGDPLV RWS Sbjct: 14 LVLLALFIAVLLSALAVSYCAYWNRQLLNASNSCSPGDPLVLERPPPRWS 63 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G P ++SCSPGDPLV RWS Sbjct: 6 GTTERPGSNSCSPGDPLVLERPPPRWS 32 >SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 0.58 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 128 DGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 D LCN H ++SCSPGDPLV RWS Sbjct: 6 DYSLCN---NGPHEQTSNSCSPGDPLVLERPPPRWS 38 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V R++SCSPGDPLV RWS Sbjct: 3 VVRSNSCSPGDPLVLERPPPRWS 25 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N R++SCSPGDPLV RWS Sbjct: 16 NGQFERSNSCSPGDPLVLERPPPRWS 41 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 0.58 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H +++SCSPGDPLV RWS Sbjct: 3 HEKKSNSCSPGDPLVLERPPPRWS 26 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 0.77 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 102 WQQTRASCRFLQPGGSTS 49 W+ R FLQPGGSTS Sbjct: 23 WEGLRGEIEFLQPGGSTS 40 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 140 PSSNSCSPGDPLVLERPPPRWS 161 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 28.7 bits (61), Expect = 0.77 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 134 LCDGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 LC C + R++SCSPGDPLV RWS Sbjct: 49 LCSREFCASLSRLQRQGRSNSCSPGDPLVLERPPPRWS 86 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 20 PTSNSCSPGDPLVLERPPPRWS 41 >SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) Length = 153 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 80 ADSCSPGDPLV*SAA-TRWS 24 ++SCSPGDPLV A RWS Sbjct: 3 SNSCSPGDPLVLEXAPPRWS 22 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 28.7 bits (61), Expect = 0.77 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P ++W +R+ RW S RC ED Sbjct: 2970 VCCGDYGQVPPLGDKEEPHDMLKEWAQRNIRWFESDYRCLCED 3012 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 28.7 bits (61), Expect = 0.77 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 47 KLVDPPGCRNRHEARVCCQDGSYKEARRKER 139 +LVDPPGCRN + +E + KE+ Sbjct: 14 ELVDPPGCRNSMDDIALLSSTKDREKKTKEK 44 >SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.7 bits (61), Expect = 0.77 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KERP ++W + + RW S RC ED Sbjct: 551 VCCGDYGQVPPWGDKERPHDMLKEWAQGNIRWFESDYRCLSED 593 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H+ ++SCSPGDPLV RWS Sbjct: 52 HLSPSNSCSPGDPLVLERPPPRWS 75 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 28.7 bits (61), Expect = 0.77 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 HV R++SCSPGDPLV RWS Sbjct: 52 HV-RSNSCSPGDPLVLERPPPRWS 74 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 0.77 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -1 Query: 92 HVPRA-DSCSPGDPLV*S-AATRWS 24 H+ RA +SCSPGDPLV RWS Sbjct: 10 HIHRASNSCSPGDPLVLERPPPRWS 34 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 46 PTSNSCSPGDPLVLERPPPRWS 67 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 119 LCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 +C + + ++SCSPGDPLV RWS Sbjct: 1 MCGSRVSIKQQATSNSCSPGDPLVLERPPPRWS 33 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 0.77 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Frame = -1 Query: 125 GLLCNCHLGNRHVPR----ADSCSPGDPLV*S-AATRWS 24 GL N L N + R ++SCSPGDPLV RWS Sbjct: 9 GLAYNAFLCNEDLARTCFSSNSCSPGDPLVLERPPPRWS 47 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 0.77 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G V ++SCSPGDPLV RWS Sbjct: 32 GEHRVLTSNSCSPGDPLVLERPPPRWS 58 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 0.77 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -1 Query: 104 LGNR-HVPRADSCSPGDPLV*S-AATRWS 24 LGN +V ++SCSPGDPLV RWS Sbjct: 17 LGNMWNVEGSNSCSPGDPLVLERPPPRWS 45 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 0.77 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -1 Query: 107 HLGNRHVPR-ADSCSPGDPLV*S-AATRWS 24 HL + + P ++SCSPGDPLV RWS Sbjct: 55 HLRSLYFPETSNSCSPGDPLVLERPPPRWS 84 >SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2484 Score = 28.7 bits (61), Expect = 0.77 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 257 ILSRVCAVNGKFKANLPLGTFAANFATFYSFLTSLL 150 ++ CA+ G LP+ A+NF+ FY++ + L Sbjct: 1999 VVGSACAICGVLVIALPVSVVASNFSIFYTYAKARL 2034 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 5 PTSNSCSPGDPLVLERPPPRWS 26 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 18 PASNSCSPGDPLVLERPPPRWS 39 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 0.77 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 107 HLGNRHVPRADSCSPGDPLV*S-AATRWS 24 H G ++SCSPGDPLV RWS Sbjct: 6 HFGLHSQTTSNSCSPGDPLVLERPPPRWS 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -1 Query: 89 VPR-ADSCSPGDPLV*S-AATRWS 24 VPR ++SCSPGDPLV RWS Sbjct: 23 VPRPSNSCSPGDPLVLERPPPRWS 46 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 1.0 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 105 SWQQTRASCRFLQPGGSTS 49 S+ +T +S FLQPGGSTS Sbjct: 18 SFNRTDSSIEFLQPGGSTS 36 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 381 RSNSCSPGDPLVLERPPPRWS 401 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 1.0 Identities = 17/32 (53%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 113 NCHLGNRHVPRA-DSCSPGDPLV*S-AATRWS 24 N L R RA +SCSPGDPLV RWS Sbjct: 12 NIDLQKRRSKRASNSCSPGDPLVLERPPPRWS 43 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 21 RSNSCSPGDPLVLERPPPRWS 41 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 24 RSNSCSPGDPLVLERPPPRWS 44 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 10 RSNSCSPGDPLVLERPPPRWS 30 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 10 RSNSCSPGDPLVLERPPPRWS 30 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 12 RSNSCSPGDPLVLERPPPRWS 32 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 4 RSNSCSPGDPLVLERPPPRWS 24 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -1 Query: 110 CHLG-NRHVPRADSCSPGDPLV*S-AATRWS 24 CH +R V ++SCSPGDPLV RWS Sbjct: 37 CHEWLSRVVVTSNSCSPGDPLVLERPPPRWS 67 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 13 RSNSCSPGDPLVLERPPPRWS 33 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 28.3 bits (60), Expect = 1.0 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P + W +R+ RW S RCQ ED Sbjct: 1129 VCCGDYGQVPPWGDKEGPHDMLKAWAQRNIRWFESDYRCQCED 1171 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 63 PLSNSCSPGDPLVLERPPPRWS 84 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 119 LCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 L + ++ RH ++SCSPGDPLV RWS Sbjct: 8 LISANIKGRHCA-SNSCSPGDPLVLERPPPRWS 39 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 24 PGSNSCSPGDPLVLERPPPRWS 45 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 39 RSNSCSPGDPLVLERPPPRWS 59 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 128 DGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 D + N H +R ++SCSPGDPLV RWS Sbjct: 40 DSINANPHEASRSA--SNSCSPGDPLVLERPPPRWS 73 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 4 RSNSCSPGDPLVLERPPPRWS 24 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 29 RSNSCSPGDPLVLERPPPRWS 49 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 63 RSNSCSPGDPLVLERPPPRWS 83 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 19 PPSNSCSPGDPLVLERPPPRWS 40 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N V ++SCSPGDPLV RWS Sbjct: 10 NPEVGTSNSCSPGDPLVLERPPPRWS 35 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V +++SCSPGDPLV RWS Sbjct: 69 VQKSNSCSPGDPLVLERPPPRWS 91 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 558 RSNSCSPGDPLVLERPPPRWS 578 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -1 Query: 89 VPRA-DSCSPGDPLV*S-AATRWS 24 +PRA +SCSPGDPLV RWS Sbjct: 7 MPRASNSCSPGDPLVLERPPPRWS 30 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 15 RSNSCSPGDPLVLERPPPRWS 35 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 1.0 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +2 Query: 47 KLVDPPGCRNRHEARVCCQDGSYKEAR---RKERPVTPEDW*ERSKRWQNSRQRCQEE 211 +LVDPPGCRN A + + ++ +KE PE + S+ W N +E Sbjct: 14 ELVDPPGCRNSIAADANQESENAEKLASDPQKESASKPESFKVISRPWLNLEGNVNKE 71 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 26 RSNSCSPGDPLVLERPPPRWS 46 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 110 RSNSCSPGDPLVLERPPPRWS 130 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 31 RSNSCSPGDPLVLERPPPRWS 51 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 6 RSNSCSPGDPLVLERPPPRWS 26 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 107 HLGNRHVPRADSCSPGDPLV*S-AATRWS 24 HL + + ++SCSPGDPLV RWS Sbjct: 15 HLYDLALTTSNSCSPGDPLVLERPPPRWS 43 >SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -1 Query: 107 HLGNRHVPRADSCSPGDPLV*S-AATRWS 24 +L N+ + ++SCSPGDPLV RWS Sbjct: 1 NLLNQVIQGSNSCSPGDPLVLERPPPRWS 29 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 92 RSNSCSPGDPLVLERPPPRWS 112 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 20 RSNSCSPGDPLVLERPPPRWS 40 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 64 RSNSCSPGDPLVLERPPPRWS 84 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 10 RSNSCSPGDPLVLERPPPRWS 30 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 44 RSNSCSPGDPLVLERPPPRWS 64 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 47 KLVDPPGCRNRHEA--RVCCQDGSYKEARR 130 +LVDPPGCRN E R G Y++ R+ Sbjct: 14 ELVDPPGCRNSIEGCNRNLTSAGLYQKTRQ 43 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 11 RSNSCSPGDPLVLERPPPRWS 31 >SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H+ ++SCSPGDPLV RWS Sbjct: 11 HMMGSNSCSPGDPLVLERPPPRWS 34 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 G R + ++SCSPGDPLV RWS Sbjct: 30 GLRKLCESNSCSPGDPLVLERPPPRWS 56 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 24 RSNSCSPGDPLVLERPPPRWS 44 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 17 RSNSCSPGDPLVLERPPPRWS 37 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 47 KLVDPPGCRNRHEARV 94 +LVDPPGCRN A V Sbjct: 14 ELVDPPGCRNSMNANV 29 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 80 ADSCSPGDPLV*S-AATRWS 24 ++SCSPGDPLV A RWS Sbjct: 23 SNSCSPGDPLVLERAPPRWS 42 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 113 NCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 N H + ++SCSPGDPLV RWS Sbjct: 4 NSHPSASFLSSSNSCSPGDPLVLERPPPRWS 34 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 45 RSNSCSPGDPLVLERPPPRWS 65 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 59 RSNSCSPGDPLVLERPPPRWS 79 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 322 RSNSCSPGDPLVLERPPPRWS 342 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 25 RSNSCSPGDPLVLERPPPRWS 45 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H+ ++SCSPGDPLV RWS Sbjct: 15 HLKVSNSCSPGDPLVLERPPPRWS 38 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 60 RSNSCSPGDPLVLERPPPRWS 80 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 113 NCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 N + N+ ++SCSPGDPLV RWS Sbjct: 12 NIGVSNQTKQSSNSCSPGDPLVLERPPPRWS 42 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H +++SCSPGDPLV RWS Sbjct: 8 HNHKSNSCSPGDPLVLERPPPRWS 31 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -1 Query: 113 NCHLGNRHVPR--ADSCSPGDPLV*S-AATRWS 24 +C + +H P ++SCSPGDPLV RWS Sbjct: 59 SCEVVYQHFPCLISNSCSPGDPLVLERPPPRWS 91 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 7 RSNSCSPGDPLVLERPPPRWS 27 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 113 NCHLGNRHVPRA-DSCSPGDPLV*S-AATRWS 24 NC N+ +A +SCSPGDPLV RWS Sbjct: 28 NCSKLNKTAIKASNSCSPGDPLVLERPPPRWS 59 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 14 RSNSCSPGDPLVLERPPPRWS 34 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 7 RSNSCSPGDPLVLERPPPRWS 27 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 12 RSNSCSPGDPLVLERPPPRWS 32 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 55 RSNSCSPGDPLVLERPPPRWS 75 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 96 PPSNSCSPGDPLVLERPPPRWS 117 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 14 RSNSCSPGDPLVLERPPPRWS 34 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 24 PGSNSCSPGDPLVLERPPPRWS 45 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 54 RSNSCSPGDPLVLERPPPRWS 74 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 31 RSNSCSPGDPLVLERPPPRWS 51 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 214 RSNSCSPGDPLVLERPPPRWS 234 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 19 RSNSCSPGDPLVLERPPPRWS 39 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 1 RSNSCSPGDPLVLERPPPRWS 21 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 R++SCSPGDPLV RWS Sbjct: 35 RSNSCSPGDPLVLERPPPRWS 55 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 28.3 bits (60), Expect = 1.0 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 140 AFLCDGLLCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 A +C L CN L + ++ ++SCSPGDPLV RWS Sbjct: 128 AQVCFILHCNL-LFSINLITSNSCSPGDPLVLERPPPRWS 166 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N+ + ++SCSPGDPLV RWS Sbjct: 96 NKSLKISNSCSPGDPLVLERPPPRWS 121 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 29 PVSNSCSPGDPLVLERPPPRWS 50 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 1.3 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 95 RHVPRADSCSPGDPLV*S-AATRWS 24 R V ++SCSPGDPLV RWS Sbjct: 30 RGVHASNSCSPGDPLVLERPPPRWS 54 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -1 Query: 92 HVPR--ADSCSPGDPLV*S-AATRWS 24 H PR ++SCSPGDPLV RWS Sbjct: 12 HNPRTTSNSCSPGDPLVLERPPPRWS 37 >SB_28078| Best HMM Match : SGS (HMM E-Value=1.5) Length = 934 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 266 QDAILSRVCAVNGKFKANLPLGTFAANFATFYS 168 Q I+ +CAV G LP+ +NF+ +YS Sbjct: 7 QGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYS 39 >SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -1 Query: 257 ILSRVCAVNGKFKANLPLGTFAANFATFYSF 165 ++ VCA++G LP+ A+NF+ + S+ Sbjct: 386 LVGSVCAISGVLMIALPVSVVASNFSLYNSY 416 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 2 PVSNSCSPGDPLVLERPPPRWS 23 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 63 PVSNSCSPGDPLVLERPPPRWS 84 >SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 105 SWQQTRASCRFLQPGGSTS 49 +W + R FLQPGGSTS Sbjct: 43 NWIKPRLKIEFLQPGGSTS 61 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 86 PRADSCSPGDPLV*S-AATRWS 24 P ++SCSPGDPLV RWS Sbjct: 58 PVSNSCSPGDPLVLERPPPRWS 79 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 101 GNRHVPRADSCSPGDPLV*S-AATRWS 24 GN+ V ++SCSPGDPLV RWS Sbjct: 27 GNKDV--SNSCSPGDPLVLERPPPRWS 51 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 95 RHVPRA-DSCSPGDPLV*S-AATRWS 24 RH+ A +SCSPGDPLV RWS Sbjct: 21 RHLQAASNSCSPGDPLVLERPPPRWS 46 >SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) Length = 1851 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 257 ILSRVCAVNGKFKANLPLGTFAANFATFY 171 +LS CA+ G LP+ TF +NF Y Sbjct: 1790 LLSAACAIFGAITLALPVLTFVSNFNKLY 1818 >SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 93 TRASCRFLQPGGSTS 49 TR S FLQPGGSTS Sbjct: 9 TRRSIEFLQPGGSTS 23 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 27.9 bits (59), Expect = 1.3 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = -1 Query: 101 GNRHVPR---ADSCSPGDPLV*S-AATRWS 24 GN+++ + ++SCSPGDPLV RWS Sbjct: 150 GNKYIKQWIASNSCSPGDPLVLERPPPRWS 179 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -1 Query: 104 LGNRHVPRADSCSPGDPLV*S-AATRWS 24 +G ++ ++SCSPGDPLV RWS Sbjct: 15 VGAHNMAGSNSCSPGDPLVLERPPPRWS 42 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -1 Query: 116 CNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 C G ++SCSPGDPLV RWS Sbjct: 8 CRGEQGKYKSSTSNSCSPGDPLVLERPPPRWS 39 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 47 KLVDPPGCRN-RHEARVCCQDGSYKEARRKERPVT 148 +LVDPPGCRN + V D Y ++ ++ +T Sbjct: 14 ELVDPPGCRNSMFDTLVSLGDLDYSNSKDLQKHLT 48 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 NR ++SCSPGDPLV RWS Sbjct: 65 NRGKGGSNSCSPGDPLVLERPPPRWS 90 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N + ++SCSPGDPLV RWS Sbjct: 5 NDGIKTSNSCSPGDPLVLERPPPRWS 30 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -1 Query: 116 CNCHL-GNRHVPRADSCSPGDPLV*S-AATRWS 24 C C + G ++SCSPGDPLV RWS Sbjct: 148 CECRMEGINCEVGSNSCSPGDPLVLERPPPRWS 180 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -1 Query: 104 LGNRHVP-RADSCSPGDPLV*S-AATRWS 24 + +HV ++SCSPGDPLV RWS Sbjct: 20 IAEKHVKFTSNSCSPGDPLVLERPPPRWS 48 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 ++ ++SCSPGDPLV RWS Sbjct: 16 YIRESNSCSPGDPLVLERPPPRWS 39 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 107 HLGNRHVPRADSCSPGDPLV*S-AATRWS 24 H G ++SCSPGDPLV RWS Sbjct: 77 HSGLNEHSLSNSCSPGDPLVLERPPPRWS 105 >SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 108 PSWQQTRASCRFLQPGGSTS 49 PS Q + FLQPGGSTS Sbjct: 11 PSEQMRSSDIEFLQPGGSTS 30 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N+ ++SCSPGDPLV RWS Sbjct: 13 NQRPRESNSCSPGDPLVLERPPPRWS 38 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 99 QQTRASCRFLQPGGSTS 49 Q T+ + FLQPGGSTS Sbjct: 9 QHTKPTIEFLQPGGSTS 25 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 110 CHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 CH+ + + ++SCSPGDPLV RWS Sbjct: 2 CHV-SLSLRASNSCSPGDPLVLERPPPRWS 30 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -1 Query: 107 HLGNRHVPR-ADSCSPGDPLV*S-AATRWS 24 +LG V ++SCSPGDPLV RWS Sbjct: 41 YLGEMEVTHTSNSCSPGDPLVLERPPPRWS 70 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 113 NCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 NC ++ ++SCSPGDPLV RWS Sbjct: 16 NCLNKCHNIVISNSCSPGDPLVLERPPPRWS 46 >SB_3220| Best HMM Match : Ion_trans (HMM E-Value=5.6e-22) Length = 256 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 257 ILSRVCAVNGKFKANLPLGTFAANFATFYS 168 I+ +CA++G LP+ +NF FY+ Sbjct: 167 IVGALCAISGVLTIALPVPVIVSNFENFYN 196 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 N V ++SCSPGDPLV RWS Sbjct: 12 NIRVFESNSCSPGDPLVLERPPPRWS 37 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 104 LGNRHVPRADSCSPGDPLV*S-AATRWS 24 L N ++SCSPGDPLV RWS Sbjct: 3 LNNLCYKTSNSCSPGDPLVLERPPPRWS 30 >SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) Length = 605 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 257 ILSRVCAVNGKFKANLPLGTFAANFATFY 171 I+ +CA+ G LP+ NF+T+Y Sbjct: 392 IIGSLCAICGVLIIGLPVSVIGNNFSTYY 420 >SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 382 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P E+W + + RW S RC ED Sbjct: 312 VCCGDYGQVSPWGNKEGPHDMLEEWAQGNIRWFESDYRCLCED 354 >SB_37320| Best HMM Match : GP46 (HMM E-Value=5) Length = 555 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P E+W + + RW S RC ED Sbjct: 509 VCCGDYGQVPPWEDKEGPHDMLEEWAQGNIRWFESDYRCPCED 551 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 47 KLVDPPGCRNRHE 85 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 >SB_28194| Best HMM Match : ResIII (HMM E-Value=0.72) Length = 309 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P E+W + + RW S RC ED Sbjct: 256 VCCGDYGQVPPWEDKEGPHDMLEEWAQGNIRWFESDYRCPCED 298 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 107 HLGNRHVPRADSCSPGDPLV*S-AATRWS 24 HL ++ ++SCSPGDPLV RWS Sbjct: 35 HLSHKR-SSSNSCSPGDPLVLERPPPRWS 62 >SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 418 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P E+W + + RW S RC ED Sbjct: 348 VCCGDYGQVSPWGNKEGPHDMLEEWAQGNIRWFESDYRCLCED 390 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 104 LGNRHVPRADSCSPGDPLV*S-AATRWS 24 + R + ++SCSPGDPLV RWS Sbjct: 1 MAGRRLFLSNSCSPGDPLVLERPPPRWS 28 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 22 KSNSCSPGDPLVLERPPPRWS 42 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 80 ADSCSPGDPLV*S-AATRWS 24 ++SCSPGDPLV + RWS Sbjct: 43 SNSCSPGDPLVLERSPPRWS 62 >SB_8959| Best HMM Match : PAN (HMM E-Value=0.013) Length = 450 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -1 Query: 230 GKFKANLPLGTFAANFATFYSFLTSLLV*LAFLCDGLLCNCHLGN 96 G F+ ++ G NF+ FY FL + L G+L N H+ N Sbjct: 294 GTFRVDVVDGPATNNFSVFYQFLMVATM-LNVALPGILLNIHILN 337 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 47 KLVDPPGCRNRHEAR 91 +LVDPPGCRN + R Sbjct: 14 ELVDPPGCRNSMKQR 28 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 108 PSWQQTRASCRFLQPGGSTS 49 P+ RA+ FLQPGGSTS Sbjct: 34 PTDPTLRANIEFLQPGGSTS 53 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 H ++SCSPGDPLV RWS Sbjct: 29 HFRVSNSCSPGDPLVLERPPPRWS 52 >SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) Length = 500 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P E+W + + RW S RC ED Sbjct: 317 VCCGDYGQVSPWGNKEGPHDMLEEWAQGNIRWFESDYRCLCED 359 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V ++SCSPGDPLV RWS Sbjct: 12 VSSSNSCSPGDPLVLERPPPRWS 34 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 + +++SCSPGDPLV RWS Sbjct: 22 IRQSNSCSPGDPLVLERPPPRWS 44 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 188 KSNSCSPGDPLVLERPPPRWS 208 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V +++SCSPGDPLV RWS Sbjct: 185 VIQSNSCSPGDPLVLERPPPRWS 207 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 21 KSNSCSPGDPLVLERPPPRWS 41 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 +RH+ ++SCSPGDPLV RWS Sbjct: 20 DRHL--SNSCSPGDPLVLERPPPRWS 43 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 20 KSNSCSPGDPLVLERPPPRWS 40 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 + ++SCSPGDPLV RWS Sbjct: 543 IQESNSCSPGDPLVLERPPPRWS 565 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 92 HVPRADSCSPGDPLV*S-AATRWS 24 ++ ++SCSPGDPLV RWS Sbjct: 12 NIVESNSCSPGDPLVLERPPPRWS 35 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 80 ADSCSPGDPLV*S-AATRWS 24 ++SCSPGDPLV + RWS Sbjct: 36 SNSCSPGDPLVLERSPPRWS 55 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V ++SCSPGDPLV RWS Sbjct: 4 VQASNSCSPGDPLVLERPPPRWS 26 >SB_43215| Best HMM Match : ResIII (HMM E-Value=7.9) Length = 235 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P ++W + + RW S RCQ ED Sbjct: 109 VCCGDYGQVPPWGDKEGPHDMLKEWAQGNIRWFESDYRCQCED 151 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 14 KSNSCSPGDPLVLERPPPRWS 34 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 5 KSNSCSPGDPLVLERPPPRWS 25 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 3 KSNSCSPGDPLVLERPPPRWS 23 >SB_35990| Best HMM Match : ResIII (HMM E-Value=2) Length = 798 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KERP ++W + + RW S RC ED Sbjct: 735 VCCGDYGQVPPWGDKERPHDMLKEWAQGNIRWFESDYRCLCED 777 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 3 KSNSCSPGDPLVLERPPPRWS 23 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G R KE P ++W + + RW S RC ED Sbjct: 563 VCCGDYGQVPPWRDKEGPHDMLKEWAQGNIRWFESDYRCLCED 605 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V ++SCSPGDPLV RWS Sbjct: 9 VDASNSCSPGDPLVLERPPPRWS 31 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G R KE P ++W + + RW S RC ED Sbjct: 501 VCCGDYGQVPPWRDKEGPHDMLKEWAQGNIRWFESDYRCLCED 543 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V ++SCSPGDPLV RWS Sbjct: 89 VSTSNSCSPGDPLVLERPPPRWS 111 >SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 V ++SCSPGDPLV RWS Sbjct: 6 VQTSNSCSPGDPLVLERPPPRWS 28 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 4 KSNSCSPGDPLVLERPPPRWS 24 >SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) Length = 551 Score = 27.1 bits (57), Expect = 2.3 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P EDW + + RW S RC ED Sbjct: 477 VCCGDYGQVLPWGDKEGPHDMLEDWIQGNIRWFESDYRCLCED 519 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 47 KLVDPPGCRNRHE 85 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 + ++SCSPGDPLV RWS Sbjct: 86 IQTSNSCSPGDPLVLERPPPRWS 108 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 98 NRHVPRADSCSPGDPLV*S-AATRWS 24 +R ++SCSPGDPLV RWS Sbjct: 9 SRATKTSNSCSPGDPLVLERPPPRWS 34 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 119 LCNCHLGNRHVPRADSCSPGDPLV*S-AATRWS 24 L + ++ N V ++SCSPGDPLV RWS Sbjct: 8 LISANIANAKV--SNSCSPGDPLVLERPPPRWS 38 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 28 KSNSCSPGDPLVLERPPPRWS 48 >SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) Length = 906 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G KE P ++W +R+ RW S RC ED Sbjct: 680 VCCGDYGQVPPWGDKEGPHDMLKEWAQRNIRWFESDYRCLCED 722 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = -1 Query: 110 CHLGNRHVPR----ADSCSPGDPLV*S-AATRWS 24 CH P ++SCSPGDPLV RWS Sbjct: 20 CHTSQNKRPENKALSNSCSPGDPLVLERPPPRWS 53 >SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1030 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 92 VCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 214 VCC D G R KE P ++W + + RW S RC ED Sbjct: 781 VCCGDYGQVPPWRDKEGPHDMLKEWAQGNIRWFESDYRCLCED 823 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 27.1 bits (57), Expect = 2.3 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = -1 Query: 125 GLLCNCHLGNRHVPR---ADSCSPGDPLV*S-AATRWS 24 GL NC + + + ++SCSPGDPLV RWS Sbjct: 152 GLESNCAARTKPLTQEKGSNSCSPGDPLVLERPPPRWS 189 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 89 VPRADSCSPGDPLV*S-AATRWS 24 + ++SCSPGDPLV RWS Sbjct: 19 INESNSCSPGDPLVLERPPPRWS 41 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 83 RADSCSPGDPLV*S-AATRWS 24 +++SCSPGDPLV RWS Sbjct: 6 QSNSCSPGDPLVLERPPPRWS 26 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 93 TRASCRFLQPGGSTS 49 T+ S FLQPGGSTS Sbjct: 21 TKPSIEFLQPGGSTS 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,917,255 Number of Sequences: 59808 Number of extensions: 187244 Number of successful extensions: 2203 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2203 length of database: 16,821,457 effective HSP length: 68 effective length of database: 12,754,513 effective search space used: 293353799 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -