BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A20 (275 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X59357-1|CAA42007.1| 128|Homo sapiens Epstein-Barr virus small ... 36 0.017 D17652-1|BAA04545.1| 128|Homo sapiens HBp15/L22 protein. 36 0.017 CR456873-1|CAG33154.1| 128|Homo sapiens RPL22 protein. 36 0.017 BC066314-1|AAH66314.1| 128|Homo sapiens ribosomal protein L22 p... 36 0.017 BC058887-1|AAH58887.1| 128|Homo sapiens ribosomal protein L22 p... 36 0.017 BC035566-1|AAH35566.1| 128|Homo sapiens ribosomal protein L22 p... 36 0.017 AL031847-9|CAI19448.1| 128|Homo sapiens ribosomal protein L22 p... 36 0.017 AF136171-1|AAP97261.1| 128|Homo sapiens heparin-binding protein... 36 0.017 AB061849-1|BAB79487.1| 39|Homo sapiens ribosomal protein L22 p... 36 0.017 DQ471908-1|ABF18985.1| 393|Homo sapiens killer cell immunoglobu... 31 0.86 DQ371508-1|ABD38570.1| 410|Homo sapiens killer Ig receptor prot... 31 0.86 DQ315410-1|ABC41943.1| 97|Homo sapiens killer cell immunoglobu... 31 0.86 AY987958-1|ABC03226.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987950-1|ABC03234.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987943-1|ABC03233.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987942-1|ABC03232.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987940-1|ABC03230.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987939-1|ABC03229.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987938-1|ABC03228.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY987937-1|ABC03227.1| 393|Homo sapiens KIR antigen protein. 31 0.86 AY083461-1|AAM00023.1| 197|Homo sapiens killer cell immunoglobu... 31 0.86 AM493896-1|CAM35484.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AM490781-1|CAM32721.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AL133414-1|CAC40702.1| 410|Homo sapiens 1060P11.1 (killer cell ... 31 0.86 AJ938065-1|CAI79400.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938064-1|CAI79399.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938062-1|CAI79397.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938061-1|CAI79396.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938060-1|CAI79395.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938059-1|CAI79394.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938058-1|CAI79393.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938057-1|CAI79392.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938056-1|CAI79391.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938055-1|CAI79390.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938054-1|CAI79389.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938053-1|CAI79388.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AJ938052-1|CAI79387.1| 410|Homo sapiens killer cell immunoglobu... 31 0.86 AF352324-1|AAK30258.1| 410|Homo sapiens killer cell Ig-like rec... 31 0.86 AF072410-1|AAC99763.1| 410|Homo sapiens killer cell inhibitory ... 31 0.86 AC006293-2|AAD03159.1| 410|Homo sapiens killer cell inhibitory ... 31 0.86 D31872-2|BAA06671.1| 518|Homo sapiens metalloprotease/disintegr... 29 2.6 D31872-1|BAA06670.1| 664|Homo sapiens metalloprotease/disintegr... 29 2.6 D17390-1|BAA04213.1| 524|Homo sapiens MDC protein protein. 29 2.6 AB009675-1|BAA32352.1| 769|Homo sapiens MDC/ADAM11 protein. 29 2.6 AL365412-1|CAB96956.1| 144|Homo sapiens hypothetical protein, s... 29 3.5 AK055900-1|BAB71040.1| 181|Homo sapiens protein ( Homo sapiens ... 29 3.5 AF363689-1|AAK73515.1| 1608|Homo sapiens capicua protein protein. 29 3.5 AC006486-3|AAD11988.1| 1453|Homo sapiens BC85722_1 protein. 29 3.5 AB002304-1|BAA20765.1| 1451|Homo sapiens KIAA0306 protein. 29 3.5 DQ471910-1|ABF18987.1| 393|Homo sapiens killer cell immunoglobu... 28 4.6 DQ471909-1|ABF18986.1| 393|Homo sapiens killer cell immunoglobu... 28 4.6 DQ371500-1|ABD38569.1| 410|Homo sapiens killer Ig receptor prot... 28 4.6 DQ315411-1|ABC41944.1| 77|Homo sapiens killer cell immunoglobu... 28 4.6 DQ315409-1|ABC41942.1| 97|Homo sapiens killer cell immunoglobu... 28 4.6 BC107708-1|AAI07709.1| 122|Homo sapiens RPL22L1 protein protein. 28 4.6 BC062731-1|AAH62731.1| 132|Homo sapiens RPL22L1 protein protein. 28 4.6 AY987941-1|ABC03231.1| 393|Homo sapiens KIR antigen protein. 28 4.6 AY083462-1|AAM00024.1| 97|Homo sapiens killer cell immunoglobu... 28 4.6 AJ938066-1|CAI79401.1| 410|Homo sapiens killer cell immunoglobu... 28 4.6 AJ938063-1|CAI79398.1| 410|Homo sapiens killer cell immunoglobu... 28 4.6 >X59357-1|CAA42007.1| 128|Homo sapiens Epstein-Barr virus small RNA associated protein protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >D17652-1|BAA04545.1| 128|Homo sapiens HBp15/L22 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >CR456873-1|CAG33154.1| 128|Homo sapiens RPL22 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >BC066314-1|AAH66314.1| 128|Homo sapiens ribosomal protein L22 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >BC058887-1|AAH58887.1| 128|Homo sapiens ribosomal protein L22 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >BC035566-1|AAH35566.1| 128|Homo sapiens ribosomal protein L22 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >AL031847-9|CAI19448.1| 128|Homo sapiens ribosomal protein L22 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >AF136171-1|AAP97261.1| 128|Homo sapiens heparin-binding protein HBp15 protein. Length = 128 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >AB061849-1|BAB79487.1| 39|Homo sapiens ribosomal protein L22 protein. Length = 39 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 219 LKFTIDCTHPAEDSILD 269 LKFT+DCTHP ED I+D Sbjct: 19 LKFTLDCTHPVEDGIMD 35 >DQ471908-1|ABF18985.1| 393|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >DQ371508-1|ABD38570.1| 410|Homo sapiens killer Ig receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >DQ315410-1|ABC41943.1| 97|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 97 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 47 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 78 >AY987958-1|ABC03226.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987950-1|ABC03234.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987943-1|ABC03233.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987942-1|ABC03232.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987940-1|ABC03230.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987939-1|ABC03229.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987938-1|ABC03228.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY987937-1|ABC03227.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 280 >AY083461-1|AAM00023.1| 197|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 197 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 147 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 178 >AM493896-1|CAM35484.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AM490781-1|CAM32721.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AL133414-1|CAC40702.1| 410|Homo sapiens 1060P11.1 (killer cell immunoglobulin-like receptor, two domains, long cytoplas protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938065-1|CAI79400.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938064-1|CAI79399.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938062-1|CAI79397.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938061-1|CAI79396.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938060-1|CAI79395.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938059-1|CAI79394.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938058-1|CAI79393.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938057-1|CAI79392.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938056-1|CAI79391.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938055-1|CAI79390.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938054-1|CAI79389.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938053-1|CAI79388.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AJ938052-1|CAI79387.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AF352324-1|AAK30258.1| 410|Homo sapiens killer cell Ig-like receptor CD158z protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AF072410-1|AAC99763.1| 410|Homo sapiens killer cell inhibitory receptor KIRCI protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >AC006293-2|AAD03159.1| 410|Homo sapiens killer cell inhibitory receptor KIRCI protein. Length = 410 Score = 30.7 bits (66), Expect = 0.86 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T N+ F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGSF 297 >D31872-2|BAA06671.1| 518|Homo sapiens metalloprotease/disintegrin-like protein protein. Length = 518 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 8 REQGGSSTGWRRSKLVDPPGCRNRH-EARVCCQDGSYKEARR 130 +E GGS + KL+DPP C N EA C GS +E R Sbjct: 322 QEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSR 363 >D31872-1|BAA06670.1| 664|Homo sapiens metalloprotease/disintegrin-like protein protein. Length = 664 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 8 REQGGSSTGWRRSKLVDPPGCRNRH-EARVCCQDGSYKEARR 130 +E GGS + KL+DPP C N EA C GS +E R Sbjct: 322 QEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSR 363 >D17390-1|BAA04213.1| 524|Homo sapiens MDC protein protein. Length = 524 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 8 REQGGSSTGWRRSKLVDPPGCRNRH-EARVCCQDGSYKEARR 130 +E GGS + KL+DPP C N EA C GS +E R Sbjct: 328 QEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSR 369 >AB009675-1|BAA32352.1| 769|Homo sapiens MDC/ADAM11 protein. Length = 769 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 8 REQGGSSTGWRRSKLVDPPGCRNRH-EARVCCQDGSYKEARR 130 +E GGS + KL+DPP C N EA C GS +E R Sbjct: 427 QEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSR 468 >AL365412-1|CAB96956.1| 144|Homo sapiens hypothetical protein, similar to (NP_006139.1) LASP-1, LIM and SH3 domain prote protein. Length = 144 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 262 MLSSAGCVQSMVNLRLIFLLAPLPRILPPFTPFL 161 M++ G + LRL F P P +LP F PFL Sbjct: 40 MMTWVGRCTAFSFLRLPFPSLPFPSVLPSFAPFL 73 >AK055900-1|BAB71040.1| 181|Homo sapiens protein ( Homo sapiens cDNA FLJ31338 fis, clone MAMGL1000184. ). Length = 181 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -2 Query: 196 LPRIL--PPFTPFLPVFWCNWPFFATGFFVTAILATD 92 LP I PP PFLP+ W + FF G +A L + Sbjct: 66 LPHICSQPPLGPFLPLTWPSCGFFGLGGAASASLGLE 102 >AF363689-1|AAK73515.1| 1608|Homo sapiens capicua protein protein. Length = 1608 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 79 PIPAARGIH*FRAPPPGGATALFP 8 P P A+ + +APPPGG+ L P Sbjct: 896 PPPKAQSVSPVQAPPPGGSAQLLP 919 >AC006486-3|AAD11988.1| 1453|Homo sapiens BC85722_1 protein. Length = 1453 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 79 PIPAARGIH*FRAPPPGGATALFP 8 P P A+ + +APPPGG+ L P Sbjct: 741 PPPKAQSVSPVQAPPPGGSAQLLP 764 >AB002304-1|BAA20765.1| 1451|Homo sapiens KIAA0306 protein. Length = 1451 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 79 PIPAARGIH*FRAPPPGGATALFP 8 P P A+ + +APPPGG+ L P Sbjct: 739 PPPKAQSVSPVQAPPPGGSAQLLP 762 >DQ471910-1|ABF18987.1| 393|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 393 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 280 >DQ471909-1|ABF18986.1| 393|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 393 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 280 >DQ371500-1|ABD38569.1| 410|Homo sapiens killer Ig receptor protein. Length = 410 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 297 >DQ315411-1|ABC41944.1| 77|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 77 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYS 168 L+ V VNG F+AN PLG T N+ F S Sbjct: 47 LTAVLRVNGTFQANFPLGPVTHGGNYRCFGS 77 >DQ315409-1|ABC41942.1| 97|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 97 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 47 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 78 >BC107708-1|AAI07709.1| 122|Homo sapiens RPL22L1 protein protein. Length = 122 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 222 KFTIDCTHPAEDSILDVG 275 +F +D THP ED I D G Sbjct: 15 RFNLDLTHPVEDGIFDSG 32 >BC062731-1|AAH62731.1| 132|Homo sapiens RPL22L1 protein protein. Length = 132 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 222 KFTIDCTHPAEDSILDVG 275 +F +D THP ED I D G Sbjct: 25 RFNLDLTHPVEDGIFDSG 42 >AY987941-1|ABC03231.1| 393|Homo sapiens KIR antigen protein. Length = 393 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 249 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 280 >AY083462-1|AAM00024.1| 97|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 97 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 47 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 78 >AJ938066-1|CAI79401.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 297 >AJ938063-1|CAI79398.1| 410|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 410 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 254 LSRVCAVNGKFKANLPLG--TFAANFATFYSF 165 L+ V VNG F+AN PLG T + F SF Sbjct: 266 LTAVLRVNGTFQANFPLGPVTHGGTYRCFGSF 297 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,784,276 Number of Sequences: 237096 Number of extensions: 1027163 Number of successful extensions: 2750 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 2621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2747 length of database: 76,859,062 effective HSP length: 69 effective length of database: 60,499,438 effective search space used: 1330987636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -