BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A20 (275 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42587-1|AAB17433.1| 299|Drosophila melanogaster ribosomal prot... 37 0.004 BT025837-1|ABF85737.1| 299|Drosophila melanogaster IP11377p pro... 37 0.004 AY118961-1|AAM50821.1| 299|Drosophila melanogaster LD40873p pro... 37 0.004 AL132792-4|CAB60023.1| 299|Drosophila melanogaster EG:BACR19J1.... 37 0.004 AF080131-1|AAD19341.1| 312|Drosophila melanogaster ribosomal pr... 37 0.004 AE014298-104|AAF45546.1| 299|Drosophila melanogaster CG7434-PA ... 37 0.004 AE013599-2559|AAF57791.1| 649|Drosophila melanogaster CG18635-P... 27 2.7 BT001558-1|AAN71313.1| 817|Drosophila melanogaster RE12611p pro... 27 3.6 AY061445-1|AAL28993.1| 588|Drosophila melanogaster LD38235p pro... 27 3.6 AE014297-682|AAF54174.2| 817|Drosophila melanogaster CG2698-PA ... 27 3.6 X85998-1|CAA59990.1| 110|Drosophila melanogaster elastin like p... 26 6.2 AY122135-1|AAM52647.1| 309|Drosophila melanogaster GH28416p pro... 26 8.2 AE014297-1467|AAF54767.1| 292|Drosophila melanogaster CG17645-P... 26 8.2 >U42587-1|AAB17433.1| 299|Drosophila melanogaster ribosomal protein Rpl22 protein. Length = 299 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 213 ISLKFTIDCTHPAEDSILDV 272 +SL+FTIDCT+ AEDSI+DV Sbjct: 189 VSLRFTIDCTNIAEDSIMDV 208 >BT025837-1|ABF85737.1| 299|Drosophila melanogaster IP11377p protein. Length = 299 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 213 ISLKFTIDCTHPAEDSILDV 272 +SL+FTIDCT+ AEDSI+DV Sbjct: 189 VSLRFTIDCTNIAEDSIMDV 208 >AY118961-1|AAM50821.1| 299|Drosophila melanogaster LD40873p protein. Length = 299 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 213 ISLKFTIDCTHPAEDSILDV 272 +SL+FTIDCT+ AEDSI+DV Sbjct: 189 VSLRFTIDCTNIAEDSIMDV 208 >AL132792-4|CAB60023.1| 299|Drosophila melanogaster EG:BACR19J1.4,FBgn0015288;RpL22 protein. Length = 299 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 213 ISLKFTIDCTHPAEDSILDV 272 +SL+FTIDCT+ AEDSI+DV Sbjct: 189 VSLRFTIDCTNIAEDSIMDV 208 >AF080131-1|AAD19341.1| 312|Drosophila melanogaster ribosomal protein L22 protein. Length = 312 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 213 ISLKFTIDCTHPAEDSILDV 272 +SL+FTIDCT+ AEDSI+DV Sbjct: 202 VSLRFTIDCTNIAEDSIMDV 221 >AE014298-104|AAF45546.1| 299|Drosophila melanogaster CG7434-PA protein. Length = 299 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 213 ISLKFTIDCTHPAEDSILDV 272 +SL+FTIDCT+ AEDSI+DV Sbjct: 189 VSLRFTIDCTNIAEDSIMDV 208 >AE013599-2559|AAF57791.1| 649|Drosophila melanogaster CG18635-PA protein. Length = 649 Score = 27.5 bits (58), Expect = 2.7 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +2 Query: 35 WRRSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQR 199 W + VD C+ R+CC+ + ++ R ER +T + E K +N R R Sbjct: 224 WATPQQVDSHRCQLEQNERLCCE--AERKKRESERTIT--SFPESDKIMENFRAR 274 >BT001558-1|AAN71313.1| 817|Drosophila melanogaster RE12611p protein. Length = 817 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 241 VQSMVNLRLIFLLAPLPRILPPFTPFLPVFWCNWPFF 131 V ++ R++FL + L +L PFL +WC P F Sbjct: 686 VHTVFGARIVFLPSALAAMLAA-APFLGSYWCAVPAF 721 >AY061445-1|AAL28993.1| 588|Drosophila melanogaster LD38235p protein. Length = 588 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 241 VQSMVNLRLIFLLAPLPRILPPFTPFLPVFWCNWPFF 131 V ++ R++FL + L +L PFL +WC P F Sbjct: 457 VHTVFGARIVFLPSALAAMLAA-APFLGSYWCAVPAF 492 >AE014297-682|AAF54174.2| 817|Drosophila melanogaster CG2698-PA protein. Length = 817 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 241 VQSMVNLRLIFLLAPLPRILPPFTPFLPVFWCNWPFF 131 V ++ R++FL + L +L PFL +WC P F Sbjct: 686 VHTVFGARIVFLPSALAAMLAA-APFLGSYWCAVPAF 721 >X85998-1|CAA59990.1| 110|Drosophila melanogaster elastin like protein protein. Length = 110 Score = 26.2 bits (55), Expect = 6.2 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 47 KLVDPPGCRN 76 +LVDPPGCRN Sbjct: 11 ELVDPPGCRN 20 >AY122135-1|AAM52647.1| 309|Drosophila melanogaster GH28416p protein. Length = 309 Score = 25.8 bits (54), Expect = 8.2 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 35 WRRSKLVDPPGCRNRHEARVC-CQDGSYKEARRKE 136 WRRS PP HE C +D YK+ + E Sbjct: 170 WRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPE 204 >AE014297-1467|AAF54767.1| 292|Drosophila melanogaster CG17645-PA protein. Length = 292 Score = 25.8 bits (54), Expect = 8.2 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 35 WRRSKLVDPPGCRNRHEARVC-CQDGSYKEARRKE 136 WRRS PP HE C +D YK+ + E Sbjct: 153 WRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPE 187 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,628,989 Number of Sequences: 53049 Number of extensions: 283408 Number of successful extensions: 824 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 24,988,368 effective HSP length: 70 effective length of database: 21,274,938 effective search space used: 446773698 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -