BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A20 (275 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 0.30 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 0.30 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 0.30 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 0.30 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 0.30 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 0.30 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 0.30 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 0.93 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 2.8 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 2.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 2.8 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 20 4.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 20 4.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 20 4.9 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 20 6.5 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 19 8.6 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.30 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 41 RSKLVDPPGCRNRHEARVCCQDGSYKEARRKERPVTPEDW*ERSKRWQNSRQRCQE 208 + KL++ RNR+ + SYK R ++ E ERS R + R+RC+E Sbjct: 26 KEKLLEERTSRNRYSRSREREQNSYKNEREYQK--YRETSKERS-RDRTERERCKE 78 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 0.93 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 87 ASCRFLQPGGS 55 A C FL PGGS Sbjct: 66 AKCEFLNPGGS 76 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.0 bits (42), Expect = 2.8 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = -2 Query: 169 PF-LPVFWCNWPFFATGFF 116 PF LP+F W F G++ Sbjct: 56 PFSLPIFGTRWIFSCIGYY 74 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 2.8 Identities = 7/26 (26%), Positives = 12/26 (46%) Frame = -3 Query: 93 TRASCRFLQPGGSTSLERRHPVELPP 16 ++ C F Q G +H + +PP Sbjct: 442 SKTKCCFAQDDGLCPYTLKHKIRVPP 467 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 2.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 56 DPPGCRNRHEAR 91 +P CR RHE R Sbjct: 518 EPSACRPRHEIR 529 Score = 20.2 bits (40), Expect = 4.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 245 VCAVNGKFKAN 213 VCA NGK AN Sbjct: 117 VCASNGKIYAN 127 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 20.2 bits (40), Expect = 4.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 238 QSMVNLRLIFLLAPLPRILPP 176 + + R I L P PR +PP Sbjct: 140 EQIPRFRHIGPLTPFPRFIPP 160 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 20.2 bits (40), Expect = 4.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 223 LRLIFLLAPLPRILPPFTPFLPV 155 L L+ L + +ILPP + LP+ Sbjct: 273 LSLVVFLLLVSKILPPTSLVLPL 295 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.2 bits (40), Expect = 4.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 238 QSMVNLRLIFLLAPLPRILPP 176 + + R I L P PR +PP Sbjct: 381 EQIPRFRHIGPLTPFPRFIPP 401 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 19.8 bits (39), Expect = 6.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 273 QHPGCYPQQG 244 QHP PQQG Sbjct: 175 QHPHMQPQQG 184 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 19.4 bits (38), Expect = 8.6 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 271 TSRMLSSAGCVQSMVNLRLIFL 206 + RML GC+++ + RL + Sbjct: 46 SERMLRKRGCIEACLFHRLALM 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,257 Number of Sequences: 438 Number of extensions: 2053 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 5388717 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -