BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A17 (184 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 21 5.2 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 21 6.9 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 21.0 bits (42), Expect = 5.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 46 LDGKALCLLVISRIHKLLK 102 +D K +L+ SRIH+L + Sbjct: 109 IDSKFRLILIESRIHRLAR 127 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 20.6 bits (41), Expect = 6.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -3 Query: 152 ETSFSLICLRL*MRSNFFNNLWILDITSKHKALPSNYQLL 33 + LIC + + +N + L +L + + + +P NY LL Sbjct: 493 DAPMELICQSVGLSTNDRDKLDLLLLKAFLRNVPPNYNLL 532 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,759 Number of Sequences: 2352 Number of extensions: 1727 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 39 effective length of database: 472,251 effective search space used: 9917271 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -