BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A16 (455 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 2.4 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 21 4.1 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 5.5 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 20 9.5 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 2.4 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = -3 Query: 240 VELMTIAQSTRVVHGQHITIFRLRSTSFGHAQDINLKFGNLRICDRSSNKGQHHK 76 V L+ QS + H H+ + G + D N+K NL+ +G H+ Sbjct: 582 VVLVDEVQSPNLSHPFHLHGYAFNVVGIGRSPDQNVKKINLKHALDLDRRGLLHR 636 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.4 bits (43), Expect = 4.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 163 CTTKSKDGDMLTMHY 207 CT K K+G +HY Sbjct: 78 CTEKQKEGSRKIIHY 92 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.0 bits (42), Expect = 5.5 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 158 SGTLKTSILSSVTSESAIVAPTRANITKTQRNI 60 S +KT+ TSE + + N KTQ N+ Sbjct: 162 SERMKTTRALEKTSEELKIPKAKINTGKTQYNL 194 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.2 bits (40), Expect = 9.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 292 VIKGWDQGLRDMCVG 336 V K WD GLR VG Sbjct: 268 VAKLWDSGLRKPGVG 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,840 Number of Sequences: 336 Number of extensions: 1832 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -