BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A13 (567 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|c... 29 0.48 SPAC20H4.06c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 29 0.63 SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|ch... 28 0.83 SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces... 26 3.4 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 3.4 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 26 4.4 SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces... 26 4.4 SPCC338.05c |mms2|spm2|ubiquitin conjugating enzyme Mms2|Schizos... 25 7.7 >SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 29.1 bits (62), Expect = 0.48 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 219 CILGFTLSACFISRTRAVKPSLCSDSLSSTGVVPNVFL 106 CI GF ++ + +RTR + PS +LS T V+ FL Sbjct: 325 CIAGFVVNEFYTTRTRIITPS-AFKTLSLTSVMVTSFL 361 >SPAC20H4.06c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 534 Score = 28.7 bits (61), Expect = 0.63 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = -2 Query: 389 RGSAVRKSVQCS---PPLWGYVQVYNSQMP 309 +G ++ KS CS PPL G+V V+N Q P Sbjct: 256 KGKSIIKSQNCSDGLPPLPGFVVVFNLQSP 285 >SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 28.3 bits (60), Expect = 0.83 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 219 CILGFTLSACFISRTRAVKPSLCSDSLSSTGVVPNVFL 106 CI GF ++ + +RTR + PS +LS + V+ FL Sbjct: 325 CIAGFVVNELYTTRTRIIAPS-AFQTLSLSSVMVTSFL 361 >SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces pombe|chr 2|||Manual Length = 1485 Score = 26.2 bits (55), Expect = 3.4 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +2 Query: 137 DKESEHREG---FTALVRE--MKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDIV 301 D ES H EG F + E MK+ALN ++ +S ++ I FD I D V Sbjct: 985 DYESHHGEGNVHFNVTLTEAGMKEALNESLEVKFKLSRTQATSNMIAFDASGRIKKYDSV 1044 Query: 302 NIQAFDYY 325 ++Y Sbjct: 1045 EDILTEFY 1052 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 26.2 bits (55), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 447 PTNLSL-VSAPLDVRGSSIQTVKFPEFHRYT 536 PT L SA DVR +S + +FH+Y+ Sbjct: 51 PTELKARTSATFDVRSASTSPINASDFHKYS 81 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 25.8 bits (54), Expect = 4.4 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 365 PIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWK--LDSDSEIS 517 P PQ+ + +QN + + + G P K V+ + T DSDS++S Sbjct: 777 PESPPQSYESIQNDNELLQELLSMGFPREKAVIALEATNYDVNEVSDSDSKLS 829 >SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1009 Score = 25.8 bits (54), Expect = 4.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 301 DNVDQVYDAWDVKVNGAIYVWQ 236 D VD++YDAW N WQ Sbjct: 54 DYVDEMYDAWKKDPNSVHASWQ 75 >SPCC338.05c |mms2|spm2|ubiquitin conjugating enzyme Mms2|Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 260 YFDVPSIINLVDIVNIQAFDYYTPERNPKEAD 355 Y D P I+ V +N+ D T + NP + D Sbjct: 68 YPDAPPIVTFVSRINLPGVDGETGKVNPHKID 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,368,979 Number of Sequences: 5004 Number of extensions: 48903 Number of successful extensions: 163 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -