BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A12 (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22730| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_21963| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_22730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 10 KECIPRLTLRWPHRKDGWTAFRII*SWWM 96 K CIPRL L + R +G FR S W+ Sbjct: 183 KSCIPRLLLHFERRGEGTILFRDYFSLWL 211 >SB_21963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 27.1 bits (57), Expect = 7.8 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 5/112 (4%) Frame = +3 Query: 126 LNDADLPSPAEF--ICTLWIPQAKYAVRKEAIYYPGPISTTPEMPTA-ADMQLAAAVGSK 296 + A LPS +EF + L + KYA + +PGPI+ E+ +A AD + + Sbjct: 1 MQSALLPSESEFYKLYGLTNDKLKYAKPDAVVMHPGPINRGVEIESAVADGPRSLILDQV 60 Query: 297 GNQLVPEANVTISKXNFKKVSGQNNISIXHL*STFNMC--VTCLYVYADKFI 446 N + V +S +++ +N I H+ N VT LY+ K I Sbjct: 61 TNGIAVRMAV-MSMAMSGQMAEKNLIKNGHVIDPKNQLDQVTDLYIQDGKVI 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,213,018 Number of Sequences: 59808 Number of extensions: 326852 Number of successful extensions: 818 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -