BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A10 (348 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 1.9 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 4.3 EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. 22 5.7 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 22 5.7 EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. 22 7.5 EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. 21 9.9 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 21 9.9 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 21 9.9 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 21 9.9 EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. 21 9.9 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 21 9.9 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 21 9.9 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 21 9.9 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 21 9.9 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 21 9.9 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 21 9.9 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 21 9.9 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 21 9.9 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 290 GLRALLTIWAEHMSEDCRR 346 G+R +IWAE + +CR+ Sbjct: 770 GIRYASSIWAESLKFECRK 788 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 22.6 bits (46), Expect = 4.3 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -1 Query: 282 VSMYPTAPTHTIGGVSIIVTASTISFLLIFDPGRSGSRTTWVIPALYPMNAVRCTGL 112 V + + P H IGG S +A+ + L GR ++ T +P P+NA C GL Sbjct: 192 VDIAGSGPVHLIGGASAFASAAILGPRL----GRY-AKGTDPLPLGNPVNA--CMGL 241 >EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG++P Sbjct: 128 QEVKESAEWADGVVP 142 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 22.2 bits (45), Expect = 5.7 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 110 SKPVHLTAFIGYKAGMTHVVREPDRPGSKINKKEIVE 220 S P HL GY + + R PD KIN K ++ Sbjct: 636 SHPFHLH---GYAYNVVGIGRSPDSNVKKINLKHALD 669 >EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 21.8 bits (44), Expect = 7.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 7 QEVFGTSSWVDGILPQEE 60 QEV ++ W DG+ P + Sbjct: 122 QEVKESAEWADGVAPAND 139 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. Length = 163 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 114 QEVKESAEWADGVAP 128 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 117 QEVKESAEWADGVAP 131 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 117 QEVKESAEWADGVAP 131 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 112 QEVKESAEWADGVAP 126 >EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. Length = 176 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 127 QEVKESAEWADGVAP 141 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 122 QEVKESAEWADGVAP 136 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 122 QEVKESAEWADGVAP 136 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 128 QEVKESAEWADGVAP 142 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 115 QEVKESAEWADGVAP 129 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 116 QEVKESAEWADGVAP 130 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 103 QEVKESAEWADGVAP 117 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 112 QEVKESAEWADGVAP 126 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 7 QEVFGTSSWVDGILP 51 QEV ++ W DG+ P Sbjct: 116 QEVKESAEWADGVAP 130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 389,941 Number of Sequences: 2352 Number of extensions: 6989 Number of successful extensions: 41 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24935070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -