BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A07 (561 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 25 0.59 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 25 0.59 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 25 0.59 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 0.78 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 23 2.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 2.4 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 3.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 4.1 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 24.6 bits (51), Expect = 0.59 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 414 CRRTNTSALPSIHASKSSXTNILLKQLNICKNKF 515 C +NTS++ S++ + TN KQL + +F Sbjct: 239 CLGSNTSSMLSLNCLNTGRTNFTNKQLTELEKEF 272 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 24.6 bits (51), Expect = 0.59 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 414 CRRTNTSALPSIHASKSSXTNILLKQLNICKNKF 515 C +NTS++ S++ + TN KQL + +F Sbjct: 28 CLGSNTSSMLSLNCLNTGRTNFTNKQLTELEKEF 61 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 24.6 bits (51), Expect = 0.59 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 414 CRRTNTSALPSIHASKSSXTNILLKQLNICKNKF 515 C +NTS++ S++ + TN KQL + +F Sbjct: 28 CLGSNTSSMLSLNCLNTGRTNFTNKQLTELEKEF 61 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 24.2 bits (50), Expect = 0.78 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 139 VVEGDASSEIPVRAGLLISRAQLVLFADVAYFTLSLNKN 255 V++ + S A LL R+ LVL D + +LNKN Sbjct: 126 VLDEEEKSSTKHYAALLTERSSLVLRNDFRLMSNNLNKN 164 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 192 DQQACAHRNLRGSVSLNH 139 DQ C+HR +R + L H Sbjct: 13 DQDQCSHRIVREHLGLKH 30 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 192 DQQACAHRNLRGSVSLNH 139 DQ C+HR +R + L H Sbjct: 327 DQDQCSHRIVREHLGLKH 344 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 192 DQQACAHRNLRGSVSLNH 139 DQ C+HR +R + L H Sbjct: 560 DQDQCSHRIVREHLGLKH 577 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 192 DQQACAHRNLRGSVSLNH 139 DQ C+HR +R + L H Sbjct: 560 DQDQCSHRIVREHLGLKH 577 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 2.4 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -3 Query: 532 TINNRGNLFLQIFNCFNNIFVIDDLEAW 449 TIN +G +++F C ++ + + W Sbjct: 267 TINGQGQFNIEMFLCNMSLLTVIPIHVW 294 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 3.1 Identities = 11/23 (47%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Frame = +2 Query: 266 STCVQR*----MLCPTGWTGGGC 322 +TCVQ LC GWTG C Sbjct: 112 ATCVQNKNQYQCLCGVGWTGKVC 134 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 92 DFSEKWLRSMIIVLW*WLRETL 157 +FS W R+ ++V+ WL L Sbjct: 153 NFSGSWKRARVLVMLAWLLSIL 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,006 Number of Sequences: 336 Number of extensions: 2703 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -