BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_A03 (485 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 0.60 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 4.2 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 4.2 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 23 7.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 22 9.7 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 26.2 bits (55), Expect = 0.60 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -2 Query: 346 DLFVNSQGTGIWRLNYYMSIIDYYHLLIFFIQLMVDSLGIMLMSP 212 DL++ ++ W+ Y +ID L IFFI ++GI++ +P Sbjct: 461 DLYIQTRED--WK--YVAMVIDRLQLYIFFIVTTAGTVGILMDAP 501 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 Query: 218 VTTGCSCCMAFRTYPRWSNGTRQPR 144 V GCS C A T R+ G R Sbjct: 138 VAAGCSICAAQTTVKRYPTGVNATR 162 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 4.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 309 RQIPVP*LFTNRSHSAFIFHVSWVL 383 RQ+P L+T R H F++S VL Sbjct: 907 RQVPDVRLWTGRKHGEVDFYLSQVL 931 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 22.6 bits (46), Expect = 7.3 Identities = 6/22 (27%), Positives = 12/22 (54%) Frame = +3 Query: 87 INTSVMQASTKVDAKGHGVTWL 152 + + +T+ D HG+TW+ Sbjct: 320 LTKELRNGNTRTDDSAHGMTWI 341 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.2 bits (45), Expect = 9.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 309 RQIPVP*LFTNRSHSAFIFHVSWVLDSTH*YRNF 410 R IP L+ +R H FH+S VL +R + Sbjct: 905 RMIPDLHLWMSRRHGEVDFHLSQVLTGHGYFREY 938 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,817 Number of Sequences: 2352 Number of extensions: 9054 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -