Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP03_T7_N23
         (953 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_06_0074 + 25375431-25375631,25375785-25376195,25376474-253765...    29   7.2  

>05_06_0074 +
           25375431-25375631,25375785-25376195,25376474-25376589,
           25377016-25377064,25377722-25378247,25378339-25379060
          Length = 674

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -1

Query: 464 GYTFIIGTCIFYSLSINLSINALTICXGAIVDXPVSTGPLRFFCA-ISCYIIE*HFFNID 288
           G+TF++ T  F +  + LSI    +     V    ST P    C+ ++ Y I+ H  NID
Sbjct: 212 GHTFLLHTAFFCNCQLFLSIPQKKLIAILYVSFLRSTSPQSLTCSMVNLYYID-HELNID 270


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,414,324
Number of Sequences: 37544
Number of extensions: 279230
Number of successful extensions: 466
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 462
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 466
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2752963900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)