SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP03_FL5_O16
         (894 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    23   3.8  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   8.7  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   8.7  
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     22   8.7  

>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 23.0 bits (47), Expect = 3.8
 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%)
 Frame = +2

Query: 245 KECKICS----RPFTVFRWCPGARMRFKKTEICQTCSKLKNVCQTCLLDLEYGL 394
           + C  C     R  +V  +CP A+   KK     T + L+ +C+ C    EY +
Sbjct: 73  RSCMCCQESGEREASVSLFCPRAKPGEKKFRKVITKAPLECMCRPCTSVEEYAI 126


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 54  LSHFYMQLNH 25
           L+HFY  LNH
Sbjct: 228 LNHFYFMLNH 237


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 54  LSHFYMQLNH 25
           L+HFY  LNH
Sbjct: 228 LNHFYFMLNH 237


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +2

Query: 473 QNLESQLSNSDPTQPTNS 526
           +NL S LS SD T+P  S
Sbjct: 540 ENLSSGLSISDSTKPETS 557


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 222,821
Number of Sequences: 438
Number of extensions: 4679
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -