Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP03_FL5_F10
         (835 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    26   0.49 
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    25   1.1  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    23   4.6  
EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    22   6.1  
AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    22   8.0  

>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 25.8 bits (54), Expect = 0.49
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +2

Query: 704 IRGESYYVCCLEP 742
           +R E++Y+CC EP
Sbjct: 210 VRNEAFYICCEEP 222


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 707 RGESYYVCCLEP 742
           R E YY CC EP
Sbjct: 224 RNEEYYPCCTEP 235


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 707 RGESYYVCCLEP 742
           R E YY CC EP
Sbjct: 206 RNEIYYNCCPEP 217


>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 11/36 (30%), Positives = 14/36 (38%)
 Frame = -1

Query: 787 VNRXAFSAARYVPTIGLQATDIITFPSYLALYPQFH 680
           VN   F  A     +  Q T  + FP    + PQ H
Sbjct: 131 VNEGQFLKAFVAAVLTRQDTQSVIFPPVYEILPQHH 166


>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
           opsin protein.
          Length = 371

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -1

Query: 199 LSATNKIR*FTQRIYTFNIFI 137
           L+ TN+IR F   I+TF+  I
Sbjct: 202 LTDTNEIRIFVATIFTFSYCI 222


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 225,393
Number of Sequences: 438
Number of extensions: 5170
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26702940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)