BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= FWDP03_FL5_B19
(814 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 26 0.48
>AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate
receptor 1 protein.
Length = 953
Score = 25.8 bits (54), Expect = 0.48
Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Frame = +1
Query: 157 DKRLQEEL-NMLVDKLLGNEVDLYFPALQMLSNLIRT 264
D RL+ + N+ + G+ VD+YF LSN+ RT
Sbjct: 676 DARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRT 712
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 197,223
Number of Sequences: 438
Number of extensions: 4121
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25853301
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -