Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP03_FL5_B15
         (861 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC036825-1|AAH36825.1|  229|Homo sapiens Unknown (protein for IM...    33   1.8  

>BC036825-1|AAH36825.1|  229|Homo sapiens Unknown (protein for
           IMAGE:5191998) protein.
          Length = 229

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 345 WSTFDAMADELLDPC-LSTLGDRQTSYHTVLASFHLESASLLCPHRFVCCTVVTITLTEN 521
           W+  + + +EL+DP  L   G R+    +VLA  H++  + +    F C + + + +T +
Sbjct: 126 WNFLNYVTEELVDPYKLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSD 185

Query: 522 SYSFI 536
            Y+ I
Sbjct: 186 MYTLI 190


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,005,662
Number of Sequences: 237096
Number of extensions: 2696275
Number of successful extensions: 15500
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11681
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15500
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10984231046
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)