BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_D22 (829 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ... 26 5.7 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 25 9.9 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 9.9 >SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 26.2 bits (55), Expect = 5.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 344 RKAHPLPG*KRKSPTP*KCTFPNPTPXVKHVPYPVKE 454 R P G R+SP+P + P+ P VP P + Sbjct: 348 RSPSPRSGRPRRSPSPSHLSIPSTLPPADGVPKPTPD 384 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.4 bits (53), Expect = 9.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 324 FPFPTPXEKHIPYPVRKENPLPRESARSPTL 416 F P P E+H+ + + E PL + R P L Sbjct: 258 FLLPKPDEQHVVFVIGLEPPLRQGQTRYPFL 288 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 25.4 bits (53), Expect = 9.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 327 PFPTPXE--KHIPYPVRKENPLPRESARSPTL--PRLS 428 P PTP +P P K P+P S+ +P++ PR S Sbjct: 1218 PVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSS 1255 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,549 Number of Sequences: 5004 Number of extensions: 42632 Number of successful extensions: 107 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 406444570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -