BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_C22 (844 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 89 4e-20 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 89 4e-20 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 83 2e-18 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 4.0 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 5.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 7.0 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 7.0 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.2 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 89.0 bits (211), Expect = 4e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +1 Query: 607 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEV 747 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEV Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEV 47 Score = 38.7 bits (86), Expect = 6e-05 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +2 Query: 755 AGDPTWGGEDFDNRMVNHFVQEFXRKXK 838 AGD GGEDFDNR+V + Q+F +K K Sbjct: 51 AGDTHLGGEDFDNRLVEYCTQDFKKKHK 78 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 89.0 bits (211), Expect = 4e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +1 Query: 607 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEV 747 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEV Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEV 47 Score = 38.7 bits (86), Expect = 6e-05 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +2 Query: 755 AGDPTWGGEDFDNRMVNHFVQEFXRKXK 838 AGD GGEDFDNR+V + Q+F +K K Sbjct: 51 AGDTHLGGEDFDNRLVEYCTQDFKKKHK 78 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 83.4 bits (197), Expect = 2e-18 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = +1 Query: 607 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEV 747 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEV 46 Score = 31.5 bits (68), Expect = 0.009 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +2 Query: 755 AGDPTWGGEDFDNRMVNHFVQEFXRKXKR 841 +GD GGEDFD +++++F++ +K K+ Sbjct: 50 SGDTHLGGEDFDQKVMDYFIKMVKQKHKK 78 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 562 TKDAGTISGLNVLRIINEPTAA 627 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.2 bits (45), Expect = 5.3 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +3 Query: 450 FH-GAYENEGNCQSL---SWQNCA---ECSYHGSRVLQ*LSKTSHKRCR 575 FH GA+ EG C+S ++ N + EC +G V+ ++T+ K CR Sbjct: 15 FHFGAFTCEG-CKSFFGRTYNNISSISECKNNGECVINKKNRTACKACR 62 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 7.0 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 379 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAKAYLGKT 504 D KPKI+ + ED+ E+ K K T L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 135 LXVGVFQXREGGDHRQRPGQQDH 203 + VG R+ DHR RP + H Sbjct: 241 IPVGHIPIRQCDDHRDRPPRHFH 263 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 9.2 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = -3 Query: 524 VITAFCTVLPR*ALAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCF-M 348 +ITAF +VLP+ A +++ F L K + Y + + + ++ + C+ + Sbjct: 87 LITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLGPYLSSYVLMATAIDRHQAICYPL 146 Query: 347 SACTVASSNLRPMRRLA 297 + C+ S + M LA Sbjct: 147 TYCSWTSRRSKVMVYLA 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,846 Number of Sequences: 336 Number of extensions: 4205 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -