BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_C13 (880 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 28 0.13 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 2.8 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 2.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.7 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 23 4.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 8.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 8.6 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 27.9 bits (59), Expect = 0.13 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 548 AIFQAAVSSVEDHGYVMDLGIP 613 ++ QAA SSV D Y+++LG P Sbjct: 408 SVIQAATSSVSDDLYLLELGFP 429 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 224 IFLSSKSLRPGINLLGRVIHVSDVKIKVSMPCKLLGNVM 340 IF +SKSLR N+ + + D+ + MP ++ + M Sbjct: 81 IFSTSKSLRTPSNMFIVSLAIFDIIMAFEMPMLVISSFM 119 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 224 IFLSSKSLRPGINLLGRVIHVSDVKIKVSMPCKLLGNVM 340 IF +SKSLR N+ + + D+ + MP ++ + M Sbjct: 81 IFSTSKSLRTPSNMFIVSLAIFDIIMAFEMPMLVISSFM 119 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 3.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 653 RDWHLXSAGTLLC*VCRGPL 594 RD HL TL C V RG L Sbjct: 620 RDLHLGERTTLTCSVTRGDL 639 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 22.6 bits (46), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 224 IFLSSKSLRPGINLLGRVIHVSD 292 IFLS+KSLR NL + +SD Sbjct: 42 IFLSTKSLRTPSNLFVINLAISD 64 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 558 KQQCHQLKITGM*WTSAY 611 K+ C+QL I + W SA+ Sbjct: 498 KRGCYQLAINHIRWNSAF 515 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 558 KQQCHQLKITGM*WTSAY 611 K+ C+QL I + W SA+ Sbjct: 588 KRGCYQLAINHIRWNSAF 605 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,465 Number of Sequences: 438 Number of extensions: 3746 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -