BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_C10 (833 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 26 0.49 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.86 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 2.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 6.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.8 bits (54), Expect = 0.49 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 580 EVIPDTDKMVCGMKGV 627 +VIP T + VCG+KG+ Sbjct: 532 DVIPGTQEHVCGVKGI 547 Score = 24.2 bits (50), Expect = 1.5 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 5/94 (5%) Frame = -1 Query: 500 PTGKKALTLMSATYLEVGPAVQRTLSIIPDAVLLITAPM----ISSPVFTLSKKCLNLAV 333 PTG+ L ++ T L P + +I PD+ L+T ++ V +S L A Sbjct: 722 PTGQLLLDYLTDTVLAYKPKILGKPTISPDSRHLVTLDKQETGVTLVVQEISSDGLKFAF 781 Query: 332 -LSTFRNVSNGGINAYKLSSGTRVSVPLVDDEGV 234 + T N+S+ + + + G + +D E + Sbjct: 782 DVKTTLNISDIALYPSQTTHGYDIYASSIDKENI 815 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.0 bits (52), Expect = 0.86 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +1 Query: 223 LLEDTPSSSTNGTETLVPEDNLYALMPPFE-TF-LNVDKTARLRHFFDNVKTGEL 381 +L P S GT ++P+DN +P E F LNV+ ++ + T +L Sbjct: 1047 ILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFRLNVETAKTNEEMWELIDTEKL 1101 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 247 STNGTETLVPEDNLYALMPPFETFLNVDKTARLRH 351 S ET++ ++ Y L PP E + +T R R+ Sbjct: 109 SRQDIETIIRRNSRYPLRPPQEVISHYRRTRRDRY 143 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 650 RGIIGPRVTPFMPQT 606 RG++GP+ PF T Sbjct: 32 RGVVGPKPVPFFGTT 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,145 Number of Sequences: 438 Number of extensions: 4301 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -