BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_C07 (864 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0645 + 4890647-4890682,4891684-4891929,4892021-4892317,489... 30 2.1 03_03_0059 + 14149796-14150350,14152303-14152433,14153479-141535... 29 4.8 >01_01_0645 + 4890647-4890682,4891684-4891929,4892021-4892317, 4892407-4892574,4892674-4892841,4892924-4893004, 4893105-4893171,4893657-4893751,4894027-4894099, 4894177-4894247,4894325-4894374,4895263-4895375, 4895461-4895513 Length = 505 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/75 (25%), Positives = 33/75 (44%) Frame = +3 Query: 426 YYVWFLGAQESRGLRGEEFALPAITLLEERARELEPFXVTLQVSHKGLKIIQNVTAKGKQ 605 ++ W GA+ S L +F LP +T+ +EP + G+KI T G Sbjct: 40 FWTWLTGAR-SNALPPPDFTLPGVTIPPPLPDLVEPGKTKITTLANGVKIASE-TTPGPS 97 Query: 606 QTIXHFIPHGSITSA 650 ++ ++ GS+ A Sbjct: 98 CSVGVYVNCGSVHEA 112 >03_03_0059 + 14149796-14150350,14152303-14152433,14153479-14153520, 14153632-14153740,14154262-14154340,14154437-14154733, 14154820-14154932,14155375-14155482,14155554-14155616, 14155698-14155865,14156283-14156348 Length = 576 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 452 LSPEEPNVIRRFLDILFKSQRHFVGALCHCWIR 354 LS E + +RR L+ ++ + ALCH WIR Sbjct: 378 LSAEAKDFVRRLLNKDYRKRMTAAQALCHPWIR 410 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,152,081 Number of Sequences: 37544 Number of extensions: 277509 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2420970504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -