BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_C05 (894 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 25 1.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 25 1.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 25 1.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 1.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.6 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 5.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 5.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 6.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.6 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 8.7 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.6 bits (51), Expect = 1.2 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 435 RTESCRSRTKRN-RHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTN 259 R R R K++ +++ + RK R + D R R S+ I ++ ++ N N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNN 95 Query: 258 SLKRT*RTNIDQTRHRPHPLPV 193 + K+ NI+ P P+PV Sbjct: 96 NYKKLQYYNINYIEQIPVPVPV 117 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.6 bits (51), Expect = 1.2 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 435 RTESCRSRTKRN-RHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTN 259 R R R K++ +++ + RK R + D R R S+ I ++ ++ N N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNN 95 Query: 258 SLKRT*RTNIDQTRHRPHPLPV 193 + K+ NI+ P P+PV Sbjct: 96 NYKKLQYYNINYIEQIPVPVPV 117 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.6 bits (51), Expect = 1.2 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 435 RTESCRSRTKRN-RHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTN 259 R R R K++ +++ + RK R + D R R S+ I ++ ++ N N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNN 95 Query: 258 SLKRT*RTNIDQTRHRPHPLPV 193 + K+ NI+ P P+PV Sbjct: 96 NYKKLQYYNINYIEQIPVPVPV 117 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.6 bits (51), Expect = 1.2 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 435 RTESCRSRTKRN-RHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTN 259 R R R K++ +++ + RK R + D R R S+ I ++ ++ N N Sbjct: 271 RYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNN 328 Query: 258 SLKRT*RTNIDQTRHRPHPLPV 193 + K+ NI+ P P+PV Sbjct: 329 NYKKLQYYNINYIEQIPVPVPV 350 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 24.2 bits (50), Expect = 1.6 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 435 RTESCRSRTKRN-RHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTN 259 R R R K++ +++ + RK R + D R R S+ I ++ ++ N N Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNN 95 Query: 258 SLKRT*RTNIDQTRHRPHPLPV 193 + K+ NI+ P P+P+ Sbjct: 96 NYKKLQYYNINYIEQIPVPVPI 117 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 5.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 199 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 297 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 5.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 199 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 297 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 435 RTESCRSRTKRNRHD 391 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 8.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 530 KHPGGPSXCXXLIRQSDSPCPCQ 462 K P PS C + ++SP C+ Sbjct: 4 KQPNRPSYCTWELNATNSPHTCR 26 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,049 Number of Sequences: 438 Number of extensions: 4432 Number of successful extensions: 20 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28904421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -