BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B20 (856 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.06 |rhp18||Rad18 homolog Rhp18|Schizosaccharomyces pomb... 29 0.84 SPAC3A11.05c |kms1||meiotic spindle pole body protein Kms1|Schiz... 28 1.9 SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharo... 27 2.6 SPAC2F7.15 |rsm24||mitochondrial ribosomal protein subunit S24|S... 26 5.9 SPAC26H5.02c |||DNA replication ATPase|Schizosaccharomyces pombe... 26 5.9 SPAC1A6.05c |||triacylglycerol lipase|Schizosaccharomyces pombe|... 26 7.8 >SPBC1734.06 |rhp18||Rad18 homolog Rhp18|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 29.1 bits (62), Expect = 0.84 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 204 RKKVSELPNCPVCSCTVRQGELEHHLDLELARLNKLTGSASKRK 335 ++K +L +CP CS V ++ HLD L + + S+S K Sbjct: 150 KRKREDLVHCPACSNLVPHNQINQHLDSCLNSPSSPSSSSSPYK 193 Score = 26.2 bits (55), Expect = 5.9 Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 525 CPVCNTTLPTSKLQRHALRCLXGTGAEMDEDIP----DTSSEEGSIGVXNDEPS 674 CP C+ +P +++ +H CL + P D S + D+ S Sbjct: 159 CPACSNLVPHNQINQHLDSCLNSPSSPSSSSSPYKNKDNSKSNSLLSFKTDDDS 212 >SPAC3A11.05c |kms1||meiotic spindle pole body protein Kms1|Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 27.9 bits (59), Expect = 1.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 124 QPSMLLYIKTGNILEINLKFVLF*VFYKSDYI 29 QP +LL + NIL + LF FY DYI Sbjct: 542 QPLLLLSVMKSNILRLFYVLFLFACFYGLDYI 573 >SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharomyces pombe|chr 1|||Manual Length = 1205 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 126 SNNVNEHNTNYGQIYDENVILNSVRSRKKVSELPN 230 S +N+ +T Y QIY+ L++V+S + +LPN Sbjct: 105 SGLMNQESTYYPQIYEILESLSNVKSAVLIVDLPN 139 >SPAC2F7.15 |rsm24||mitochondrial ribosomal protein subunit S24|Schizosaccharomyces pombe|chr 1|||Manual Length = 258 Score = 26.2 bits (55), Expect = 5.9 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 540 TTLPT-SKLQRHALRCLXGTGAEMDEDIPDTSSEEGSIGVXN 662 T +P + QRH LR L G +ED+ SS++ S + N Sbjct: 138 TNIPLLEEKQRHVLRLLVGPRYNPEEDLVRISSDKYSSALQN 179 >SPAC26H5.02c |||DNA replication ATPase|Schizosaccharomyces pombe|chr 1|||Manual Length = 504 Score = 26.2 bits (55), Expect = 5.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 231 CPVCSCTVRQGELEHHLD 284 CPVC+ TV ++ HLD Sbjct: 9 CPVCAKTVTMNDINPHLD 26 >SPAC1A6.05c |||triacylglycerol lipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 483 Score = 25.8 bits (54), Expect = 7.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 169 YICP*LVLCSFTLFEQPSMLLYIKTGNIL 83 YI V C +LFE PS+L YI N+L Sbjct: 257 YILNVTVSCG-SLFEMPSLLNYITAPNVL 284 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,917,228 Number of Sequences: 5004 Number of extensions: 54987 Number of successful extensions: 160 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 424464280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -