BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B17 (851 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 210 1e-56 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 86 4e-19 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 2.3 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 7.1 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 7.1 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 210 bits (512), Expect = 1e-56 Identities = 96/108 (88%), Positives = 99/108 (91%) Frame = +3 Query: 507 KSELATCTPRDPGVAGGDVCSSESFNEDIAVFSKQIRQEKPYYIADPEVDSLMVQAIQVL 686 K ELATCTPR+PGVAGGDVCSSESFNEDIAVFSKQIRQEKPYYIADPEVDSLMVQAIQVL Sbjct: 95 KCELATCTPREPGVAGGDVCSSESFNEDIAVFSKQIRQEKPYYIADPEVDSLMVQAIQVL 154 Query: 687 RFHLLELEKVHELCDNFCHRYISCLKGXMPIDLXIDXRXXARPPDANG 830 RFHLLELEKVHELCDNFCHRYISCLKG MPIDL ID R +PP+ G Sbjct: 155 RFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGGKPPELTG 202 Score = 35.5 bits (78), Expect = 5e-04 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +1 Query: 433 PLVHKRDKDAIYGHPLVP 486 P V KRDKDAIYGHPL P Sbjct: 70 PDVGKRDKDAIYGHPLFP 87 Score = 27.9 bits (59), Expect = 0.11 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 446 RETKTLFTGIPWFPLLALIFEK 511 + K G P FPLLALIFEK Sbjct: 74 KRDKDAIYGHPLFPLLALIFEK 95 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 85.8 bits (203), Expect = 4e-19 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +3 Query: 693 HLLELEKVHELCDNFCHRYISCLKGXMPIDLXIDXRXXARPPDANG 830 HLLELEKVHELCDNFCHRYISCLKG MPIDL ID R +PP+ G Sbjct: 1 HLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGGKPPELTG 46 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 252 SAGHHERFRSRAQPKT 205 S G H + RS+ QPKT Sbjct: 206 SRGRHNQSRSKRQPKT 221 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 572 RGAHVSARHARVPGGTGR*LTFRRSEPAGGT 480 R AHV A+ G G LTF E G T Sbjct: 76 RLAHVQAQLGAAMGAVGTALTFCLQEEGGTT 106 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 531 PRDPGVAGGDVCSSESFNEDIAVFSK 608 P G GG+VC + +D +V S+ Sbjct: 511 PTGDGALGGEVCMWGEYVDDSSVESR 536 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 651 PLDPLCNTVSLDVSVC*IPQCLR*KTPRSTRLRPP 547 P +PL N + +++ +P+ TPR RPP Sbjct: 382 PKNPLINILYANMNSYSVPEPTISTTPRPEWARPP 416 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,510 Number of Sequences: 336 Number of extensions: 4687 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -