BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B16 (857 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.06 |msp1|mgm1|mitochondrial GTPase Msp1|Schizosaccharom... 29 1.1 SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosacch... 26 6.0 >SPBC1718.06 |msp1|mgm1|mitochondrial GTPase Msp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 903 Score = 28.7 bits (61), Expect = 1.1 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 553 TLDSSWLSGIQLCRWNFNSFLQRFRKHSRTDSLRSSLRKLLIHII 419 T DS G+ + + F F Q+F K D L+SSL + ++ ++ Sbjct: 558 TADSYIAEGLDIFKAAFKEFTQKFGKSEVRDLLKSSLNEKVMDLL 602 >SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 26.2 bits (55), Expect = 6.0 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 563 PSQMLKHAVVNLINYQDDADLATRAIPELIK 655 PS+MLK V+ +NY++ + + AIP L++ Sbjct: 257 PSEMLK--VLKKVNYKEPSSIQRAAIPVLLQ 285 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,292,387 Number of Sequences: 5004 Number of extensions: 63254 Number of successful extensions: 193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -