BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B16 (857 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 25 1.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 4.8 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 265 QNSYLVDSGINSGAATQVPSLTGKEDDEMEGDQL 366 ++++L SGIN +T+ PS + +M GD++ Sbjct: 386 RSTHLKVSGINRVGSTRRPSRRNSCESQMMGDEM 419 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 219 CANGTKQRAADIDVAAK 269 CA KQRAAD D+ K Sbjct: 16 CAPNVKQRAADQDLLNK 32 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,887 Number of Sequences: 438 Number of extensions: 4188 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -