BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B14 (853 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 1.0 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 24 1.3 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 24 1.3 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 23 3.1 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 353 EKFQVRIRNQSRASNSHKHATIPE*AKLKKKKTLC 249 E ++RI + + S HK + K KKK LC Sbjct: 193 EGVEIRIPDVIKTSGPHKFQPLLRLPKFKKKPLLC 227 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 1 YGSEPRTAALEASLNLKHK*TPLKIDNQ*YKKKKN*LVLCFDY 129 Y S PR L A LNL + N+ K K+ + + + Y Sbjct: 95 YVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRMAIAWPY 137 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 24.2 bits (50), Expect = 1.3 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 279 LFRDCCVFVRIRSPALVANS-DLEFFHLQLLIIEG 380 ++R+ C FV P LV N+ +L F L L+I+EG Sbjct: 165 VWREVCTFVVQVYPRLVVNTINLTFLTL-LMILEG 198 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 419 PRENSRRSSISYLTAASRVPCHKE 490 PR+ +R S+SY T VP H E Sbjct: 56 PRDPNRARSVSYSTVIQSVP-HPE 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,117 Number of Sequences: 336 Number of extensions: 3593 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -