BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B12 (852 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 35 0.060 At3g47570.1 68416.m05179 leucine-rich repeat transmembrane prote... 30 2.2 At2g45840.1 68415.m05701 expressed protein 28 6.9 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 28 6.9 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 28 6.9 >At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family protein Length = 477 Score = 35.1 bits (77), Expect = 0.060 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +3 Query: 90 FTITHN*SYPTMT*GSNKMALRLKKDIKKASYYVWFLGAQESRG--LRGEEFALPAITLL 263 F T N S + ++A +LKK I ASY ++ SRG + ++ L Sbjct: 212 FNFTLNFSIYQIQSNFEELASQLKKGINLASYENLYITLSNSRGSTVAPPTIVHSSVLLT 271 Query: 264 EERARELEPFKVTLQVSH-KGLKIIQNVTAKGKQQTIKHFIPHGSITSA 407 + L+ T+ SH K L + V K KQ + +PH TS+ Sbjct: 272 FGSSSRLKQLAQTITSSHSKNLGLNHTVFGKVKQVRLSSILPHSPATSS 320 >At3g47570.1 68416.m05179 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 - Oryza sativa, PIR:A57676 Length = 1010 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 12 IPGFVACLLRIRSPALVANS*LGIFPFTITHN*SYPTMT*GSNKMALRLKKDI 170 IP VA L +I S LVAN+ G+FP + + S + G N + RL+ D+ Sbjct: 202 IPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDL 254 >At2g45840.1 68415.m05701 expressed protein Length = 523 Score = 28.3 bits (60), Expect = 6.9 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -3 Query: 691 SLRCSRSPTLWRLRCPATNPEASCWS-EEPRAFEACVRY-RRISFDSPAYR 545 +L+CS + CPA+NPE S S +EP E C Y R I D A+R Sbjct: 87 TLQCSLDQNIATQTCPASNPEKSQPSKDEP---ETCPDYFRWIHKDLEAWR 134 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/92 (32%), Positives = 39/92 (42%), Gaps = 5/92 (5%) Frame = -3 Query: 676 RSPTLWRLRCPATNPEASCWSEEPRAFEACVRYRRIS---FDSPAYRSALVNACRASP-P 509 RSP RLR P S P R IS PA R ++ +SP P Sbjct: 307 RSPPPRRLRSPPRRSPIRRRSRSPIRRPGRSRSSSISPRKGRGPAGRRGRSSSYSSSPSP 366 Query: 508 CAQSRICKRGREPGQPVRG-LYSSNTHATTSP 416 R R R P +P+RG SSN+ +++SP Sbjct: 367 RRIPRKISRSRSPKRPLRGKRSSSNSSSSSSP 398 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/92 (32%), Positives = 39/92 (42%), Gaps = 5/92 (5%) Frame = -3 Query: 676 RSPTLWRLRCPATNPEASCWSEEPRAFEACVRYRRIS---FDSPAYRSALVNACRASP-P 509 RSP RLR P S P R IS PA R ++ +SP P Sbjct: 314 RSPPPRRLRSPPRRSPIRRRSRSPIRRPGRSRSSSISPRKGRGPAGRRGRSSSYSSSPSP 373 Query: 508 CAQSRICKRGREPGQPVRG-LYSSNTHATTSP 416 R R R P +P+RG SSN+ +++SP Sbjct: 374 RRIPRKISRSRSPKRPLRGKRSSSNSSSSSSP 405 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,920,048 Number of Sequences: 28952 Number of extensions: 348302 Number of successful extensions: 1253 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1252 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1980143200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -