BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B11 (844 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1032 - 30259180-30260519,30260650-30260720,30261099-302621... 32 0.66 03_06_0419 - 33789625-33789843,33790884-33791185,33791279-33792248 32 0.66 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 31 1.1 12_01_0648 + 5496696-5497052 25 1.3 07_03_0793 + 21552499-21552729 30 2.0 02_05_0059 - 25482207-25482271,25482432-25482651 30 2.0 01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962 30 2.0 12_02_0837 - 23554013-23554771 30 2.7 12_02_1261 + 27410921-27413401 29 3.5 11_06_0257 + 21746643-21748091 29 3.5 10_04_0012 + 7555067-7555867 29 4.6 12_02_0992 + 25083397-25083537,25084198-25084228,25084971-250851... 29 6.1 11_03_0183 - 11310671-11313625,11314243-11314287,11314550-11314717 29 6.1 08_02_0386 - 16575636-16575698,16575799-16575858,16575947-165762... 29 6.1 04_03_0801 - 19828175-19828770,19828913-19828994 29 6.1 02_05_0419 - 28814754-28816114,28816749-28817435,28817554-288177... 29 6.1 01_05_0791 + 25267885-25267930,25268258-25268713,25268802-252688... 29 6.1 02_05_0435 - 28958422-28958665,28959328-28959462,28960056-289602... 28 8.1 02_01_0574 + 4247469-4248196,4249501-4249691,4250565-4251022 28 8.1 >04_04_1032 - 30259180-30260519,30260650-30260720,30261099-30262118, 30263886-30264121 Length = 888 Score = 31.9 bits (69), Expect = 0.66 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 184 VCTCLCGVLGWARDRNRSWWP 246 + C G++ W R RN SWWP Sbjct: 26 ITDCSPGIIVWVRRRNGSWWP 46 >03_06_0419 - 33789625-33789843,33790884-33791185,33791279-33792248 Length = 496 Score = 31.9 bits (69), Expect = 0.66 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -3 Query: 380 SQVGMGQPVLV-VHRSPLHVTSAVEALVVPRLSHESSARARV*GSAGHHERFRSRAQPK 207 + VG G P+ VH SPL TS VVP + A+ R +A R R +P+ Sbjct: 129 AMVGSGHPMAAPVHSSPLATTSGSNHAVVPDAPPQEPAKRRRRNTAAAATARRGRGRPR 187 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 424 PGXPLVHKRDKDAIYGHPLVPPAGSDLRKV 513 PG V + D +Y HP+VP AG L+ V Sbjct: 769 PGMMSVRVHETDGVYDHPIVPMAGEALQVV 798 >12_01_0648 + 5496696-5497052 Length = 118 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 396 GGSALEPGGDGSACARGTS 340 GGSA PGG+ SA G S Sbjct: 70 GGSASAPGGNSSALGSGAS 88 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 429 PRGGRERVLPAGGSALEPGG 370 P G LP GG A+ PGG Sbjct: 10 PPGSGMAALPGGGEAVLPGG 29 >07_03_0793 + 21552499-21552729 Length = 76 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 426 RGGRERVLPAGGSALEPGGDGSACARGTSL 337 +GG +RV +GG ++ GGD + ARG + Sbjct: 22 QGGGQRVNRSGGGSMRRGGDNGSLARGDDI 51 >02_05_0059 - 25482207-25482271,25482432-25482651 Length = 94 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 426 RGGRERVLPAGGSALEPGGDGSACARG 346 RGG ++V GG +++ GGD + ARG Sbjct: 22 RGGGQQVNDGGGGSMKGGGDSGSLARG 48 >01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962 Length = 774 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 202 GVLGWARDRNRSWWPAE 252 G L W R RN SWWP + Sbjct: 25 GALVWVRRRNGSWWPGQ 41 >12_02_0837 - 23554013-23554771 Length = 252 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/59 (25%), Positives = 30/59 (50%) Frame = -2 Query: 690 RSTCIACTINESTSGSAM*YGFS*RICLLNTAMSSLKDSEEHTSPPATPGSRGVQVASS 514 R C+ + + + A + + + + A++ LKD +HT+ A PG R + VA++ Sbjct: 181 RKGCVTFYVYAARTAGARGFARADELRAVVEAVAKLKDFLDHTAMLALPGQRSIDVAAA 239 >12_02_1261 + 27410921-27413401 Length = 826 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 190 TCLCGVLGWARDRNRSWWPA 249 T G L WA+ + R WWPA Sbjct: 9 TLAAGDLVWAKSKRRPWWPA 28 >11_06_0257 + 21746643-21748091 Length = 482 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = -2 Query: 408 VLPAGGSALEPGGDGSACARGTSLPPPCNL---RRGGSRRT*AEP*KLGPSPGVGLRW 244 VL G A GGD +AC P C L R G R T + P G GLRW Sbjct: 189 VLSCGPHAAAGGGDAAACVVLLLHMPRCELSYARPGDERWT-----WISPGAGTGLRW 241 >10_04_0012 + 7555067-7555867 Length = 266 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 393 GSALEPGGDGSACARGTSLPPPCNLRRGGSR 301 GS +P GD +GTS PC LR+G R Sbjct: 8 GSCRKPCGDQGRQQQGTSFLHPCPLRQGEGR 38 >12_02_0992 + 25083397-25083537,25084198-25084228,25084971-25085139, 25085228-25085291,25085408-25085474,25086543-25086586, 25086835-25086922,25087079-25087238,25087659-25087779, 25087859-25087942,25088043-25088162,25088689-25088901, 25088995-25089054,25089144-25089262,25089407-25089465, 25089585-25089919 Length = 624 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 202 GVLGWARDRNRSW-WPAEPYTRARAELSWLSLGT 300 GVLGW +NRS WP +RAR L L LG+ Sbjct: 58 GVLGWGEIKNRSCPWPVVRLSRAR--LVTLCLGS 89 >11_03_0183 - 11310671-11313625,11314243-11314287,11314550-11314717 Length = 1055 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 208 LGWARDRNRSWWPAEPYTRARAELSWLSLGTTRASTAEVTW 330 L W + R+ WWP + + A A S L+L TRA V + Sbjct: 119 LVWGKVRSHPWWPGQVFDAADA--SKLALKHTRAGAPLVAY 157 >08_02_0386 - 16575636-16575698,16575799-16575858,16575947-16576239, 16576361-16576517,16576601-16576948,16577047-16577177, 16577417-16577882,16578425-16579132 Length = 741 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -1 Query: 337 PPSM*PPPWRLSSYLG*AMKARPEPGCRAPLATTNDFGHGP 215 PPS PPPW ++ + P+P AP A G P Sbjct: 15 PPSPTPPPWLHGPHVPSTSVSPPDPATEAPPAPKQHRGPRP 55 >04_03_0801 - 19828175-19828770,19828913-19828994 Length = 225 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 399 AGGSALEPGGDGSACARGTSLPPPC 325 +GG E GG G C + PPPC Sbjct: 173 SGGHGGECGGGGGGCKKPCCSPPPC 197 >02_05_0419 - 28814754-28816114,28816749-28817435,28817554-28817774, 28818536-28818750 Length = 827 Score = 28.7 bits (61), Expect = 6.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 202 GVLGWARDRNRSWWP 246 G + W R RN SWWP Sbjct: 25 GTIVWVRRRNGSWWP 39 >01_05_0791 + 25267885-25267930,25268258-25268713,25268802-25268832, 25268949-25269255 Length = 279 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 364 PIPTWLQCTTPRRQHPLTPSPGXPLVHKRDKDAIYGHPLVPPAG 495 P PT + TTP P TP G P+ YG + PP G Sbjct: 194 PPPTPMTPTTPMTPTPTTPDTGTPIYGGSTTPPDYG-SMSPPGG 236 >02_05_0435 - 28958422-28958665,28959328-28959462,28960056-28960211, 28960287-28961092,28961177-28961254,28961809-28961883, 28962127-28962215,28962735-28962843,28963007-28963086, 28963739-28963794,28963876-28963958,28964049-28964118, 28964200-28964309,28964395-28964548,28965183-28965382, 28966175-28966348,28969080-28969277,28970564-28970791 Length = 1014 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 534 PGTLAWRAETCAPRSLSTKTLRYSA 608 PG +WR TCA LST T + + Sbjct: 774 PGHFSWRPHTCAGSGLSTDTSNHGS 798 >02_01_0574 + 4247469-4248196,4249501-4249691,4250565-4251022 Length = 458 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 293 RLSHESSARARV*GSAGHHERFRSRAQPKTPHKH 192 RL H+ V +A HH RS A+ + H+H Sbjct: 378 RLQHDGDGDDDVAAAAAHHHLMRSLARQQQQHRH 411 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,901,859 Number of Sequences: 37544 Number of extensions: 710094 Number of successful extensions: 2720 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2714 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -