BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B08 (860 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 26 0.44 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 5.4 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 22 7.2 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 25.8 bits (54), Expect = 0.44 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = -3 Query: 552 PWITKIKCRGENSKREGSYPERHVESLAEAETWEAARTLRLRALSCRP 409 PW+ + K ++S++E P R + + E + CRP Sbjct: 116 PWMKEKKTTRKSSQQENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRP 163 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 525 GENSKREGSYPERHVESLAEAETW 454 G+ SKR+G+Y R + E W Sbjct: 355 GDPSKRKGTYAFRTPDENGEGGAW 378 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 542 PKLNVEVKIPNGKAPIPNDMWNPSPKPKPGKP 447 P NV V + + + ++ NPS KPGKP Sbjct: 664 PVRNVSVDVRDNI--LLKNLQNPSTGSKPGKP 693 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/37 (21%), Positives = 17/37 (45%) Frame = +3 Query: 288 NQTQSASLSCLQGCHQQRESDPALWKRKHKAGRPKKQ 398 N + ++ L Q + DP+ W+++ K K+ Sbjct: 115 NNGTNKNMRRLSTTTQNKNDDPSYWEKRRKNNEAAKR 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,559 Number of Sequences: 336 Number of extensions: 4167 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -